KEGG   Aedes aegypti (yellow fever mosquito): 5563723Help
Entry
5563723           CDS       T01053                                 

Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00450  Selenocompound metabolism
aag00970  Aminoacyl-tRNA biosynthesis
aag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    5563723
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    5563723
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aag01007]
    5563723
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aag03016]
    5563723
Enzymes [BR:aag01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     5563723
Amino acid related enzymes [BR:aag01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   5563723
Transfer RNA biogenesis [BR:aag03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    5563723
 Prokaryotic type
   Other AARSs
    5563723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 5563723
NCBI-ProteinID: XP_001647993
UniProt: Q17E70
Position
1
AA seq 553 aa AA seqDB search
MWKNVGLRWFSSKSSNFSFVTTPIFYVNAAPHIGHLYSAVITDAIHRFNNLVHPAAQASS
IFSTGTDEHGTKIQQAATSHSVPVDTYCQQISDRYRSLFRNFNISHTRYIRTTDADHTQA
VQCFWNALERSGSIYSAQYSGWYCIPDETFLTDSQLKENNLGVKVSAESGHPVEWTEEKN
FMFRLEKYQDDVLYWIKGCEDRIVPIKFRKILLDFLQDKLPDISISRPKSRVSWGIDVPS
DPTQTVYVWLDALVNYLTVSGYPQEGFSHRWPPTVQVLGKDILKFHGIYWPAFLIAAGLE
PPRQLLVHSHWTVDGEKMSKSKGNVVDPNERASLYTHEGIRYFLLREGVAHSDGNYSDTK
IMRIINAELADTFGNLLSRCCGKVLNPEAVVPVVQQDEFNTLSQMDVTKKMLELLNELPE
KCMTHYRQYNFYLVVDSVIQVLHATNNFFESTAPWKLKKPEEKQQLQAILGVTMEVLRQA
GIILQPIVPIMSGKLLDKLSVERNRRLWTDLTLQLAEVERPLADTDAVLFRRIIPPKVEV
VKEPKAKKLKKKN
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaaatgttggacttcggtggttttccagcaaaagcagtaatttttcttttgtt
acgacacccattttctatgtaaacgctgcgccccacattggccacctttactccgcggtc
atcacagatgccattcaccggttcaacaatctcgtccaccctgccgctcaggcatcgtcg
attttcagcaccgggacggacgagcatggtaccaaaatccagcaagctgccacgagtcat
tccgtgcccgtggacacttactgccagcagatttccgaccggtatcgttctttgttccgg
aattttaacatttcgcacacgcgatatatccggacaaccgatgcggatcacacgcaagcc
gtccaatgcttctggaatgcattggaacgttctgggagcatctactcggcccagtattcc
ggctggtattgcatcccggatgagacgttcctgacggatagtcagctaaaagagaataac
cttggggtcaaggtttccgctgaatccggccatccggtcgagtggaccgaagagaagaat
ttcatgtttcgcttagaaaaataccaggatgacgtgctctactggatcaaaggctgtgaa
gatcggatagtaccgattaaattcaggaaaattttactggattttcttcaggacaaactg
ccggatatctccatctctcgacctaagtcccgggtatcctggggaatcgatgtcccgtct
gaccccacacaaaccgtgtacgtatggctggatgcgctggtcaactatttgaccgtgagt
gggtaccctcaggagggattttcccaccgttggcctccgacagtgcaagtccttggaaaa
gatattctaaaattccatgggatttattggccagcgtttctgattgcagccggtttggag
ccaccgcggcagttgctggtgcattcccattggaccgtagatggcgagaaaatgtccaag
agtaagggaaacgtcgtggatccgaatgaacgggcttcactgtatactcacgagggtata
aggtacttcctgctgagagaaggtgttgcccacagtgatggaaattacagcgacacaaaa
atcatgcgaattataaacgctgaactggcggacacatttggaaatctactttcaagatgc
tgtggtaaggtactgaatcccgaagctgtcgttcccgtcgttcaacaggacgagttcaat
accttaagtcagatggacgttaccaagaagatgcttgaactcctaaacgagttgccagaa
aaatgcatgactcactatcggcagtacaatttctatctggtggttgacagcgtaattcaa
gttctgcacgccacgaataacttcttcgagtcgaccgcaccatggaagctgaaaaaacct
gaagagaagcaacaactgcaagctatcctaggagtgaccatggaagttctgcgccaagcc
ggaataatactgcaaccgattgttccaatcatgagtgggaagttgcttgacaagctaagc
gttgaacggaatcggcgattgtggaccgatctaacgctgcaacttgcggaagtggaacga
ccgctggccgacaccgatgcggtgttgtttcggaggataattccaccgaaagtggaggtg
gttaaggagcccaaggcgaaaaagttgaaaaagaagaattaa

DBGET integrated database retrieval system