KEGG   Aedes aegypti (yellow fever mosquito): 5564353Help
Entry
5564353           CDS       T01053                                 

Definition
(RefSeq) glycogen [starch] synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00500  Starch and sucrose metabolism
aag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    5564353
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aag01003]
    5564353
Enzymes [BR:aag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     5564353
Glycosyltransferases [BR:aag01003]
 Polysaccharide
  Storage polysaccharide
   5564353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 5564353
NCBI-ProteinID: XP_001648704
UniProt: Q17DG0
Position
3
AA seq 695 aa AA seqDB search
MSRRFSRAESSSDLLAFLDRGHSANTENRWTFEIAWEVANKVGGIYTVIRSKAFVSTEEL
GDQYCLIGPYKEASARTEVEACEFPNNGPLYGAVSAMRNQGYKVHCGRWLVDGNPQIILF
DVGSAAWKMDGYKQELWESSNVGIPHLDVESNDAVILGYTIATFIAEFKRCAEQYSHDNE
YGPPRIVAHFHEWQAGVGLIALRTRHVDVATVFTTHATLLGRYLCAGNTDFYNNLDKFPV
DEEAGKRQIYHRYCLERAATHLCHVFTTVSEITGYESEHLLKRKPDIITPNGLNVKKFSA
IHEFQNLHAMAKEKIHEFTRGHFYGHFNFDLEKTLYMFIAGRYEFSNKGADIFIESLARL
NHLLKSHNPDVTVVAFLIFPAKTNNFNVESLRGHAVTKQLRETLNTIQQQIGKRMYDTCL
KGHLPDGGEILTKEDMVKIKRCLYALQRDGNPPVTTHNVVDDWNDPVLESVRRCHLFNTK
YDRVKIVFHPEFLNSTNPLFGLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTT
NLSGFGCFMQEHIADPKSYGIYIVDRRHVGLEESVQQLSKFMFEFCKLNRRQRIIQRNRT
ERLSDLLDWRNLGIYYRQARIKALQTVYPDYVDESESYLRRAADFNYPRPVSAPPSPSSS
RHTTPAPSLHGSDDEQDSVDSEEELEELKKANSHD
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggcgcttttcgcgagcagagtccagctcggacctgctggctttcctggaccgt
ggccactctgcgaatactgaaaatcgatggacttttgaaattgcatgggaagtcgccaat
aaggtgggtggaatctacaccgttattcgctccaaagcatttgtgtcgacggaagaactt
ggcgatcagtattgcctgattgggccatacaaagaagcatctgcccggacggaagttgaa
gcatgtgagtttccgaacaatgggcccctgtatggagcagtgtcagcaatgcgaaatcaa
ggctacaaggtacactgcgggcggtggctagtcgatggaaaccctcaaatcattctgttc
gacgttggatcggcggcctggaaaatggatggctacaagcaggaactgtgggaatcatca
aacgttggaataccgcatttagacgttgagagcaatgatgccgttattcttggctatact
atcgccacctttattgccgagttcaaacgttgcgctgaacaatactcgcacgacaatgaa
tacggaccaccgcgtattgtagcccatttccatgagtggcaggccggcgttggtctaatt
gctctgcgaacgcgccacgtagatgtcgccactgtgttcacaactcacgctactttgttg
ggtcggtatctgtgtgctggtaatacggacttttacaataatctagacaaattccctgtc
gatgaggaagccggaaaacgacagatttatcatcgttattgtcttgaacgtgctgctact
catctctgtcatgtgttcactactgtctcggaaattaccggttatgagtcggaacatttg
ctgaagcgaaaacctgatattatcacgcccaacgggttgaacgtgaaaaagttttctgct
atccacgaattccagaacctacacgccatggcaaaggaaaagatccatgagtttaccaga
ggccatttctacggtcacttcaactttgatttggagaagactttgtacatgtttattgcc
ggtcgctatgagttctcgaacaagggtgctgacatctttatcgagtccctggctcgattg
aatcacttgttgaaatcacacaatccggatgtaaccgtagtggcattcttaattttccct
gccaagaccaacaacttcaacgtagagtcacttcgtggacatgccgttaccaagcagcta
cgcgaaactcttaacaccattcagcagcagataggaaagcgaatgtatgacacttgcctg
aaaggacatctgcctgatggaggcgaaattttaactaaggaagacatggtcaagatcaaa
cggtgtttgtacgctctgcagcgcgatggaaatccaccggtaaccactcacaacgtcgtc
gatgactggaatgatcccgtcctggagtcagtacgacggtgccatctgttcaacacgaaa
tatgatcgtgttaaaatagttttccaccctgagtttttgaactccaccaatccattgttt
ggactggattacgaagagtttgttcgcggttgccatttgggcgtatttccctcatactac
gaaccatggggctacacaccagccgagtgtaccgtgatgggaattccaagtgttacaact
aacctctctgggttcggttgtttcatgcaggagcacattgccgaccctaagtcgtatggt
atttacattgtggatcgacgtcacgtgggactcgaggagagcgtccaacagctgtccaag
tttatgttcgagttctgcaaactcaaccggcgccagagaatcatccaacgaaaccgaact
gagcggcttagcgatctgcttgattggagaaatctaggaatttattaccgccaggctaga
ataaaagcgttgcaaaccgtgtatccagattacgtcgatgaatcggagagctatctgagg
cgagctgctgacttcaattaccctcgtccagttagtgccccaccaagtccaagttcttcc
aggcacacaacgccagctccatcactacacggatcggacgatgaacaagattccgttgat
tctgaagaagaattggaagaactgaagaaagctaactcgcatgactaa

DBGET integrated database retrieval system