KEGG   Aedes aegypti (yellow fever mosquito): 5565330Help
Entry
5565330           CDS       T01053                                 

Definition
(RefSeq) flavin reductase (NADPH)
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00740  Riboflavin metabolism
aag00860  Porphyrin and chlorophyll metabolism
aag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    5565330
   00860 Porphyrin and chlorophyll metabolism
    5565330
Enzymes [BR:aag01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     5565330
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     5565330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD GDP_Man_Dehyd
Motif
Other DBs
NCBI-GeneID: 5565330
NCBI-ProteinID: XP_001649677
UniProt: Q16FC8
Position
1
AA seq 205 aa AA seqDB search
MQKIVVFGGTGMTGQCAVQYALDKGLKVRLMVRNEATVPESFKNQVELVKGDVVNAEDVV
KAISDQELVCVVLGTRNDLKPTTMMSTGIQNIVDAMKAAHLKKVSVCLSSFLFFDADKVP
KMFTELNADHKRMLDVLKASDLEYRAILPPHIADEPSTEYVIAYDKSPGLTRSISKLDLG
KFLIEALFEDQHAGKVIGMCTKPAC
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaattgttgtatttggaggcaccggtatgaccggtcaatgtgctgtgcaatat
gcgcttgataagggcctcaaggttcgccttatggtgcgaaatgaagcaacagttccagaa
tcttttaagaatcaagtggaactagtgaagggtgatgtagtcaatgcagaggatgtagtc
aaagcgattagcgaccaggaactcgtatgcgttgtattggggacaagaaatgacctgaaa
ccgaccacaatgatgtcgactgggatccagaatattgtagatgctatgaaggctgcacat
ctcaaaaaagtatctgtatgtttgtcatccttcctgtttttcgatgcggacaaggtgcca
aagatgttcactgagttgaatgctgaccataaacggatgctggatgtactgaaggcttcc
gatttggagtatcgtgcaattcttcctccacatatcgctgatgaaccttcaaccgagtac
gttatcgcatatgacaaatcgcctggattgacgcgttcgatttccaaattagatttaggc
aagtttttgatcgaagcgctattcgaagatcaacatgctggcaaagttattggaatgtgc
acgaaacctgcttgttaa

DBGET integrated database retrieval system