KEGG   Aedes aegypti (yellow fever mosquito): 5566323Help
Entry
5566323           CDS       T01053                                 

Definition
(RefSeq) activin receptor type-1 isoform X1
  KO
K04675  activin receptor type-1 [EC:2.7.11.30]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:aag00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    5566323
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aag01001]
    5566323
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     5566323
Protein kinases [BR:aag01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   5566323
Cytokine receptors [BR:aag04050]
 TGF-beta receptors
  Type I TGF-beta receptor
   5566323
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal DUF3149 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5566323
NCBI-ProteinID: XP_021696047
Position
2
AA seq 575 aa AA seqDB search
MVFAKFGFILLLASSFAQGDLHGKLLDETEETMDLEAHHPIRDLPIQNSIVSHQRRHSKS
KRRMKRRYKCYSCEPPDCADTTAHAHLCQNAIQCWKSRIRDQYGHESVSRGCTTTHEQLP
LYCNPSLMNSSGPKKRHASGTYNIECCTGDYCNNGTFPALPPVEYGNEVMKLESSTYALK
MTGAILGPVTMLIVGATIVWYFMRRSHHKRLMASRSKHDPETYYASDEILRATSAGDSTL
REYLQHSVTSGSGSGLPLLIQRTLARQVSLCECIGRGRYGEVWRGIWHGESVAVKIFFSR
DEDSWKRETEIYSTVLLRHENILGYIGSDMTSRNSCTQLWLITHYYPLGSLFDHLNRTAL
SHHQMATICLSIANGLVHLHTEIFGTEGKPAIAHRDLKTKNILVRINGSCVIADFGLAVT
HSQTTNKIDMGNTARVGTKRYMAPEVLDESINMECFESLRKADIYAIGLMFWEICRRTLS
NGIAEDYKVPFYDCVTSDPSFEEMRKVVCGDNYRPSIPNRWVSDPLLSGMAKLMRECWHA
NSNVRLPALRIKKTLLKLASLDETVKLNYDGEICV
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttgcaaagttcggttttattttgctgctggcgtccagtttcgcccaaggagat
ctgcacggcaagctgctggatgagaccgaagaaacgatggacctggaggcacaccacccg
attcgtgatcttccaatacagaattcaatcgtgtcccatcagaggcgccactccaaatcc
aagagacggatgaaacgaagatacaaatgctacagctgcgaaccgcccgactgcgccgac
acgacggcccatgcccacctctgccagaatgcgatccagtgctggaagtcgcgaatccgt
gaccagtacgggcacgagagcgtatcccgcggctgtacgaccacccacgagcaacttccc
ctctactgcaatcccagcctgatgaacagcagtggaccgaagaaacggcacgcctccgga
acgtacaacatcgagtgctgcaccggagactactgcaacaacgggacgttcccagcgttg
ccaccggtggagtatggaaatgaagtgatgaagctagagagctcaacctatgcactgaaa
atgacgggggccattctgggtccggtgacgatgctgatcgtaggcgctacaattgtttgg
tacttcatgcgccgatcgcaccacaagcgactaatggcttccaggagtaagcatgatccg
gagacctattacgccagtgatgaaattctcagggccaccagtgccggggacagtacgctt
cgggaatatcttcaacactcggttacgtccggttcgggtagtggtttgccgcttttgatt
cagcgtacactggcccggcaggtgtcgctgtgcgagtgtatcggtcgcggtcgatacgga
gaggtgtggcgaggcatctggcacggggagagcgtggccgtgaaaatatttttctcgcgc
gacgaggactcgtggaagcgcgagacggagatctacagtacggtactgctgcggcacgag
aacattctcggctacattgggtcggacatgacctcgcggaattcgtgcacccagctttgg
cttatcacgcactattacccgctgggatcgctgtttgatcatctgaaccggactgccttg
agccatcaccagatggcgacgatttgcctttcaattgccaacggtttggtgcatctgcac
acagaaatcttcggcacggaaggtaaaccggcaatcgctcatcgtgacctgaaaacgaag
aatatccttgtgcgcatcaacggatcgtgtgtgatagccgactttggccttgccgtgacg
cacagtcagacgactaacaagatcgacatgggtaatacggctcgagtcggaaccaagcgt
tacatggcaccggaagtgctggatgagagcataaacatggaatgcttcgagtccctacgc
aaggcagacatctacgcgatcggactgatgttctgggagatctgcaggcgcactctgtcg
aatggcatcgccgaggactataaggttccgttttacgactgcgtcacgtccgatccgagc
ttcgaagagatgcgaaaggtggtctgtggcgataactatcgaccatcgataccaaatcgc
tgggtttcggatccgctcctgtccggcatggccaaattgatgcgcgagtgctggcacgcc
aactcgaatgtgcgtctgccggcgctgcggataaagaagacgctactgaagttggccagt
ttggacgaaacggtcaagctcaactacgacggggagatctgcgtttga

DBGET integrated database retrieval system