KEGG   Aedes aegypti (yellow fever mosquito): 5566375Help
Entry
5566375           CDS       T01053                                 

Definition
(RefSeq) myotubularin-related protein 2
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00562  Inositol phosphate metabolism
aag01100  Metabolic pathways
aag04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:aag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5566375
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    5566375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aag01009]
    5566375
Enzymes [BR:aag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     5566375
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     5566375
Protein phosphatases and associated proteins [BR:aag01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    5566375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM 3-PAP Y_phosphatase Y_phosphatase3 DSPc
Motif
Other DBs
NCBI-GeneID: 5566375
NCBI-ProteinID: XP_021702361
Position
2
AA seq 607 aa AA seqDB search
MDHHNSEFHRSSNSLDSDSKSSSLNSKHGMDTIVANESSFTYLSGENMQDIKNDVSYICP
YSGPVVGTLTITNYRLHFRSQPSSDKDPVVIVDCPLGAVSRIEKVGGASSRGENSYGIDI
FCKDMRNLRFAHKQENHSRRTVFEKLQLYAFPLANSQQLFAFNYKERFPEDGWSVYEPVA
ELRRMGVNSANNDTWRITRINDKYEICDSYPSVWAVPKTAKDDLVRQVANFRSRNRLPVL
CWIHPKSLATITRCSQPLVGVSGKRNEADETYINYIMEANAQSDKLSIFDARPNANAIAN
KAKGGGYESEDAYKNVELTFLDIHNIHVMRESLRKLKEICFPASDDQKWLSAVESTLWLK
HIKCILAGAVRIVDRIENMRMSVVVHCSDGWDRTSQLTALAMLLLDPYYRTLKGFEVLIE
KEWLSFGHKFEQRIGHGDNHHSDADRSPVFLQFIDCVWQITKQFPHGLEFNEYFLITILD
HLYSCRFGTFLYNTERERVQNDLKNRTVSLWSFINSSHEQYRNPLYGGRSMAIQTVLKPV
VSMRHIRLWKGLYCRWNPSMRQQDPIYQRTRELLALQDQLLKQVEECRLEKTQQRTHQSG
RLTSPLH
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggatcatcacaattcggaatttcaccggagctctaattcgctggattccgactcgaag
tcaagttcgctgaactcgaagcacggaatggatacgattgttgccaatgagtcctcattc
acctatctctccggagaaaatatgcaggacatcaagaacgatgtgtcgtacatctgtccg
tacagtggaccggttgtgggcactttgactataacgaactacaggctgcacttccggtcg
cagccttcgagtgacaaagacccagtggtgattgtagattgccccttgggagccgtaagt
cgcatagagaaagtgggaggagctagttccagaggggaaaattcctatggtattgacatt
ttctgcaaggacatgcgaaatctacgcttcgctcataagcaagaaaaccattcgaggcgg
accgttttcgaaaagcttcaattgtacgcgtttccattggcgaatagccaacaactgttt
gccttcaattacaaggaaaggtttcctgaggacggttggagtgtatatgagccagtggct
gaactgcgaagaatgggcgtcaatagcgccaacaacgacacatggaggataaccagaatc
aacgataaatatgagatctgcgacagttacccttcggtgtgggctgttccaaagacggcc
aaggatgatttggtacgacaagttgctaacttccgatctcgcaatcgcttacctgtactc
tgctggattcacccaaagtctctggccacgattactcgctgttcccagccgttagtcgga
gtgagcggaaaacgaaacgaagccgatgagacctacatcaattacatcatggaagcgaat
gctcagtcggacaagctctcgatcttcgatgcccggccgaatgccaatgccattgcgaac
aaggccaagggcggtggctatgaatcggaagacgcgtacaaaaatgtcgaacttacattt
ctggacatccacaacattcacgttatgcgtgagagtttacgaaaattgaaggaaatctgc
tttccggccagcgatgatcagaagtggctttctgcggttgagagcactttgtggttgaag
cacatcaaatgcattttggccggggcagtacggatcgttgataggatcgagaacatgcgc
atgtcagttgtggttcactgctcggatgggtgggaccgcacatcccaacttacagcgctc
gctatgctcttgctggacccgtattatcgcactttgaagggatttgaagtgttgatcgaa
aaggaatggcttagctttggacacaaattcgaacagcgtatcggacacggggacaatcac
cattcggatgcggatcgatcaccggtgttcctacagttcattgactgtgtgtggcaaata
acgaagcagtttccgcacggtttggagttcaatgaatactttttgatcaccattctggac
catctgtattcctgtcgatttggaacgtttctgtacaacacagagcgggagcgggttcaa
aatgatctgaaaaatcgcaccgtctcgctgtggtcgtttataaattcatcccacgaacag
tatcgtaatccgctgtacggcggccgcagtatggccatccagacagtgctgaaaccggtc
gtcagcatgcgacacatacgcctctggaaggggctgtactgccggtggaacccaagcatg
cggcaacaggatcccatttatcagcgtacgcgagagctgctcgccttgcaggaccaactg
ctcaaacaggtggaggaatgtcgactggagaaaactcaacagcggacacaccaatcggga
cgattgacttcaccattgcattaa

DBGET integrated database retrieval system