KEGG   Aedes aegypti (yellow fever mosquito): 5568428Help
Entry
5568428           CDS       T01053                                 

Definition
(RefSeq) dihydropteridine reductase isoform X1
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00790  Folate biosynthesis
aag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    5568428
Enzymes [BR:aag01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     5568428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase
Motif
Other DBs
NCBI-GeneID: 5568428
NCBI-ProteinID: XP_001652256
UniProt: Q1HQQ6
Position
3
AA seq 235 aa AA seqDB search
MASGKVLIYGGRGALGASCVQYFKNNNYWVGCIDLAENESADVNIVVDRDADWVSQEQSV
LSQVESSLKGDKLDAVICVAGGWAGGNATKDLAKNSDLMWKQSVWSSTISATVGANHLKT
GGLLALTGANPALAGTPGMIGYGMAKAAVHQLTKSLSGKDSGLPEQALVVSILPVTLDTP
MNRKWMPNADFGTWTPLEFVAELFHKWTKNEERPASGSLVKLITKDSKTELVMAE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggccagcggtaaggttctgatctacggaggacgaggtgccctcggagcgtcatgcgtc
cagtatttcaagaacaataactattgggtaggttgtatcgaccttgccgaaaacgagtct
gccgatgtgaacattgtcgtcgaccgggatgccgactgggtttcccaagagcaaagtgtg
ctgtcgcaggttgaatcatctctgaagggagacaaactggatgctgtgatctgcgttgcc
ggcggatgggctggtggtaatgccacgaaggatctggccaagaattccgatctgatgtgg
aagcaatcggtttggtcttcgaccatttcggccaccgtcggggctaatcacctcaagaca
gggggattgttggctttgactggagccaaccctgctctggccggaacgcccggtatgatt
ggctatggcatggcgaaggccgccgtccaccaattaaccaagagcttatctggcaaggat
tctggattgccggaacaagcacttgtcgtttccatcctgcccgtcactttggacactccc
atgaatcgtaaatggatgcccaatgccgacttcggaacatggacaccattggagtttgtt
gccgagctcttccacaagtggaccaaaaacgaagaacgccccgccagtggcagtctcgtg
aagttgatcaccaaggattccaaaactgagctggtaatggccgaataa

DBGET integrated database retrieval system