KEGG   Aedes aegypti (yellow fever mosquito): 5568808Help
Entry
5568808           CDS       T01053                                 

Definition
(RefSeq) protein phosphatase 1 regulatory subunit 7 isoform X3
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
KEGG Orthology (KO) [BR:aag00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aag01009]
    5568808
Protein phosphatases and associated proteins [BR:aag01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5568808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_9 LRR_8
Motif
Other DBs
NCBI-GeneID: 5568808
NCBI-ProteinID: XP_001658167
UniProt: Q17M29
Position
2
AA seq 332 aa AA seqDB search
MSENKQPEDCSAMAEDRPLTPEEEPAQEEPPKPEDMQVVKMEDVITIDPDATDVDLNHGR
IGKIERLEPLVNLERLYLRWNLIKKIENLDHLIALQELELYDNQITKLENLDNLVNLEVL
DISFNRIHKIENLDRLVKLSKLYLCANKISVIENIGHLSNLTMLELGDNKLRKIQHLDTL
TNLTKLYLGKNKITKIENLDKLVNLECLSLQCNRLVKIENLDKLVNLTELYLSENGIEKI
ENLDHNKQLDTLDLAKNRIKTIENVAHLECLEEFWMNDNSVSDWTCVDVLAANKKLATVY
LERNPIASDSTYRKKLKLAIPWLTQIDATLCR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaataaacaacccgaagattgctctgcaatggccgaagatcgaccgctgaca
ccggaagaggaaccggctcaggaagaaccacccaagccggaggatatgcaggtggttaag
atggaagatgtgattacgatcgatccggatgcgaccgatgttgacctgaaccatggacgg
atcgggaaaatagaacggttggaaccgttggtcaatctagaaaggctttatctgcgatgg
aatctgatcaagaaaatcgaaaatttggatcatttgatcgcccttcaggagctagaactg
tacgacaatcagattacgaagctggagaacctggataacttggtcaatctggaagttttg
gacattagcttcaatcggattcacaaaatagaaaatttggatcgattagttaaattgagt
aaactatatctgtgtgcaaataagatctcagttattgaaaacattggtcatcttagcaac
ttgaccatgctggaattgggagataataagctaaggaaaattcaacacttggatacattg
acaaacttgaccaagctgtacttgggcaagaacaagatcaccaagatcgagaacttggac
aaactggtcaacctggagtgccttagcttgcagtgcaatcgactggtgaagatcgaaaac
ctagacaagctggtcaacctgacggagctgtatttgtccgagaacggaatcgaaaagatc
gaaaacctcgatcacaacaagcagctggacacgctggatttggccaaaaaccgtattaaa
accattgagaatgtggcgcatttggagtgcctggaagaattctggatgaacgacaactcc
gtctcggactggacctgcgtggatgtgttggcggcgaataaaaagttggccaccgtctat
ctggaacgtaatccaatcgcttcggatagcacctaccgtaagaagttgaagctggccatt
ccgtggttgacccaaatcgatgccacactgtgtcgttaa

DBGET integrated database retrieval system