KEGG   Aedes aegypti (yellow fever mosquito): 5568815Help
Entry
5568815           CDS       T01053                                 

Definition
(RefSeq) reticulon-4-interacting protein 1 homolog, mitochondrial
  KO
K23164  reticulon-4-interacting protein 1, mitochondrial
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
KEGG Orthology (KO) [BR:aag00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aag03029]
    5568815
Mitochondrial biogenesis [BR:aag03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    5568815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N adh_short Epimerase RmlD_sub_bind NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 5568815
NCBI-ProteinID: XP_001658181
UniProt: Q17M15
Position
2
AA seq 397 aa AA seqDB search
MFPQKCIRLVSQHLPNPTRYLSTISAGATSCSRRARPISKMCGWQIHSYGSLEEVQFSDN
LKMPVLTSPNQLLVKVTAASVNPIDVAMIKGYGAAVLNTMRCKSGIEFPLTLGRDFCGEI
VQKGMGVSSRDLDVGDEVWGVCPVHQQGSHAEYVVVERYCLSKKPENLSKIDASAVLYAG
LTAWSGLYLTGQLGNLLGAISPVGGGRGKKVLVLGAAGGVGTLAVQILLAEGVEVYATCS
TDAVEMVQNLGVRYVLDYNEPAHVQQLASVGKFDIILDCAGKGTDYATSVPWRFEQYITF
NSPVLKNIDDNGFATGMVQNAVSIVRNNLATVSAHNGLVKWGYFVPAPQGIAYLQKLVEQ
GKLLPVIEKVFTFDGTSEAYARVDEKHLRGKIVIDYN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttcccccaaaagtgcatccgtttagtgagtcaacatttgcccaaccccacccggtac
ctgtccacgatttcggccggagccaccagctgcagcagaagggctcgcccgatcagcaag
atgtgtggctggcaaattcactcctacggaagtctggaggaggtgcagtttagcgacaac
ctgaaaatgccagtcctcacgtcgccgaaccagctgctcgtgaaggtgacggccgcctcc
gtgaatccaatcgatgtcgcaatgatcaagggctacggtgcggcagtactaaatactatg
cgctgcaaaagcggcatcgagtttcctctgacactcggtcgggatttttgcggagaaatc
gtacagaaaggcatgggagtgtccagtcgagatctggacgtaggcgatgaagtgtgggga
gtttgcccggtgcaccaacagggatctcatgcagagtacgttgtcgtggaacgatattgc
ctctcgaaaaaaccggaaaatctcagcaaaatcgatgccagtgccgtgctatacgctggc
cttacggcgtggtctggtttgtatcttaccggtcagctgggaaatttactcggcgcaata
tcacccgttggtggtgggagggggaaaaaagtcttagtgttaggtgcggccgggggtgtc
gggacgctggcagttcaaattctactggctgagggcgtagaagtctacgcaacgtgctca
actgatgccgttgaaatggtacaaaatctgggagtccgatacgttttggattataacgaa
ccggcccatgtgcaacagttggcgagtgttggaaagttcgatatcatcctggattgtgcc
ggcaagggaacggactatgccacatccgtgccatggaggttcgaacagtacatcacattc
aattctcccgtgttgaaaaacatcgacgacaacggattcgcaactggcatggtccagaat
gcggtaagtatagtgcgcaacaatttggccacggtcagcgcacacaatggactggtcaag
tggggctatttcgttccggccccgcaaggcattgcgtacctgcagaagttggtggagcag
ggaaaattgttgcccgtcattgagaaagtattcacattcgatggcacttcagaagcgtac
gctcgcgttgatgagaaacacctgcgagggaaaattgtgatagattataactga

DBGET integrated database retrieval system