KEGG   Aedes aegypti (yellow fever mosquito): 5569749Help
Entry
5569749           CDS       T01053                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X2
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
KEGG Orthology (KO) [BR:aag00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aag01002]
    5569749
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aag04147]
    5569749
Enzymes [BR:aag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     5569749
Peptidases [BR:aag01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   5569749
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   5569749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 Say1_Mug180 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 5569749
NCBI-ProteinID: XP_001652963
UniProt: Q170K7
Position
3
AA seq 403 aa AA seqDB search
MPYFAMQRRPILLKICLTTCKICILVFVIIFIVLPLIFKFSFALQKSILFLTFISYPPNL
DLKRPEKSGLYATRNFFVTYRDQEEDIDVDVAVWHVLPNDLVRRFAKELQIDEPTLSNMT
APEDVREKVDAIATKDSSQYREIERILHRPNLNLDDSATQKDLFEETLRATTNDIVLYLH
GNTASRGASHRVDLYKLLRSLNYHVVTLDYRGYGDSANISPTERGVVYDALAVYQYITSI
SKNPVYLWGHSLGTGVATHLLSLLTDMSLPGPKAVVLESPFNNIREEICAHPFSKLYRHL
PWFDYTISSPMYANELRFESDQHIAEFRQPVLILHAEDDHVVPFNLGYKLYRTALDTRGK
SWGPIEFHRFEKTSHYGHRYICRAPNLPEIVIHFFRTYRNEQY
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgccctattttgcgatgcaaagaaggcccattctactgaaaatctgtttgacgacgtgc
aaaatctgcatcctggtgttcgtgatcatcttcattgtgttgccactgatattcaaattc
tcgtttgccctgcagaagagcatcctgtttctgacgtttatctcctatccgccaaatctt
gatctcaaacgtccggagaagagcggactgtacgcgacgcgtaactttttcgtcacctac
cgggaccaagaagaggacatcgatgtggatgtcgcggtgtggcacgtgcttcccaatgat
ctggttcgccggttcgccaaagaactgcaaattgatgagcctactctatccaacatgacc
gccccggaggatgtccgagagaaggtggacgcaatagctaccaaagattcgtcgcaatat
cgggaaatcgagcgaattctacaccgcccgaacctgaacctggacgatagtgccacccag
aaagacctgttcgaggagaccctacgggccaccaccaatgatattgtactttatctccac
gggaacactgcctcacggggggcttcacatcgagtggatttgtataaactgctgcgcagc
ttgaattaccacgtggtgaccctagattaccgagggtacggtgattcggccaacatctcc
ccaactgagcggggagtggtgtacgatgccctggccgtatatcagtatattaccagtatt
agtaagaatccagtttacctgtggggccattcgctggggacaggtgtggccacacatttg
ctgtccctgttgactgacatgagcttgccaggaccgaaagcagtcgttttggaaagcccc
ttcaacaatatccgggaggaaatttgtgctcatccgttctctaagttgtatcgacatctt
ccctggtttgattacaccatttcgagtcccatgtatgccaatgagttgcgtttcgagtcg
gatcagcacattgccgagttcaggcagccggtgttgattctgcatgccgaggatgatcac
gtcgttccgttcaacctaggttataagctctaccgcaccgccctggacactcgcggaaaa
tcgtggggccccatcgagttccatcggttcgagaagaccagccactacggccaccggtac
atctgccgggcaccgaacttgccggagattgtgatccacttcttccgcacgtaccgcaac
gaacagtactga

DBGET integrated database retrieval system