KEGG   Aedes aegypti (yellow fever mosquito): 5570517Help
Entry
5570517           CDS       T01053                                 

Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial
  KO
K02890  large subunit ribosomal protein L22
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aag00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    5570517
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aag03011]
    5570517
Ribosome [BR:aag03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    5570517
  Bacteria
    5570517
  Archaea
    5570517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 5570517
NCBI-ProteinID: XP_001659205
UniProt: Q17L83
Position
1
AA seq 219 aa AA seqDB search
MSHLLRSLGRLAISNSNRLVPALTALPATSTNQFHTSSTLSKKWNGHSTGPKRWLEYNKI
IYPPQEADEKPRPAFVCHQKTNIKYSPKKMWYIASFVRGMSVDEAIKQLSFIDKKGATTV
KEAILEAVELAVKRHNVEFRSNLWVAESFCGKGRVFKGFRRHGRGRFGEVEYKHSHYFVR
LEEGSPPENYYPGQEQKSGDQMLQEWLESMRKRKVIHSL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacctattgcgcagcctgggccggctggccatcagcaactccaatcgccttgtt
ccggcgctgaccgctcttccggcgacatccacaaatcagttccacacgagcagcacgttg
tccaagaagtggaacggccacagcaccggtcccaagcgatggctcgagtacaacaaaatc
atttacccaccgcaggaagctgacgagaagcccaggccagctttcgtctgccaccagaag
accaacatcaagtacagcccgaagaagatgtggtacattgccagtttcgtgaggggaatg
tccgtagatgaagccatcaagcagctgtcgtttatcgacaagaagggtgcgaccaccgtc
aaggaagcgatcctggaagccgtggaactggccgtcaagcgccacaatgtggagttccgt
tcgaacctgtgggtggcggaatcgttctgcggcaagggccgggtcttcaagggattccgg
cgacatggtcggggtcggttcggagaggtcgagtacaaacactcgcactactttgtccgg
ctggaggagggaagcccgccggagaactactatccgggacaggagcagaagagtggcgac
cagatgctgcaggagtggctggagtccatgcggaaacggaaggttatccattcgttgtaa

DBGET integrated database retrieval system