KEGG   Aedes aegypti (yellow fever mosquito): 5571860Help
Entry
5571860           CDS       T01053                                 

Definition
(RefSeq) biotin--protein ligase 2 isoform X2
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00780  Biotin metabolism
aag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    5571860
Enzymes [BR:aag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     5571860
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     5571860
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     5571860
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     5571860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C LSM
Motif
Other DBs
NCBI-GeneID: 5571860
NCBI-ProteinID: XP_001653793
UniProt: Q16W46
Position
2
AA seq 550 aa AA seqDB search
MTNQTKPPNILAYAPEPSAKACMVDMLRGLVRVDTYTVYPMTEGQMEARAWLDSTALLMV
HGQLDEGVARVAVDYFLGGGKVMAVCSNLLRLVLPNRVKDDESRNESVLLSYDRWQNTTM
EQEILDWTAEEDECREVARNSAGVEQELRIKILARESTFNTPSILNLKCLDTKGNGIFTQ
LHLNLDREPERDILKHLLDKHLEISIKECMHQEQIQYKNAFLIGSLHEKNNFLKSTQKVL
NLTNLEMRFCNSSENLPASSETKLMVLVDRHPEDFSVEDYFSTLKTSFLGRTAIYCPMVT
SSMDVVSNTTWSDGFAVISRCQSRGSGRNNNQWLSPEGCAMFSLQLHVPLASALGQRLPM
IQHLVAVAVVKAIRSIPGYEKLDIRVKWPNDIYANGCTKIGGLIINSQLCGMEAVVNVGC
GVNLSNSKPTMCINDLIREYNKLKGTSLPLLGIEQTLAYIFNEIDRIYVSVQEKDDLQDL
YDLYYKYWLHSNRSVIVKSEDGEEIAGTISGIDEYGFLLVNTNKEGKPICVHPDGNSFDM
MKGLIIPKYY
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatcaaacgaaacccccgaacattctggcatatgccccagaaccttccgcaaag
gcatgtatggtcgatatgcttcgtggcctggtacgagttgatacctacacggtttatccg
atgacggaggggcaaatggaagcacgggcctggttggacagtaccgcactgctgatggtt
cacgggcagcttgatgaaggtgtggcgagggtggcagttgattactttctgggtggtggg
aaagtaatggcagtttgttccaatttactgaggttggttttgccgaaccgagtgaaggat
gatgagagtagaaatgagagcgtattactgagctacgataggtggcaaaatacgacgatg
gaacaggagatattagactggactgcggaggaagatgaatgcagagaagttgcaaggaat
tcagccggcgttgaacaagaactgaggattaagattttggcgagggagagcactttcaac
acgccaagcattttgaatttgaaatgtttggacactaaaggaaacggtatcttcactcaa
ctacatttaaatctagacagagagcctgaaagggacatactcaagcatttactagacaag
catttggagattagtattaaggaatgtatgcatcaagagcaaatccagtacaaaaatgcc
tttctgattggcagcttacatgaaaagaacaacttcctaaaaagcacacaaaaggttctc
aatctgacaaaccttgaaatgcggttttgcaacagctcagagaatctccctgcatcttcg
gaaaccaaacttatggtcctggttgaccgccatccagaagatttctcagttgaagactat
ttcagcactttaaaaacatccttcctgggtcggaccgcaatttactgcccaatggtaacc
agttcgatggatgtcgtttctaacaccacgtggagtgatggattcgcagtcatttcccgg
tgtcaaagccgaggcagcggacggaacaacaaccagtggctgagcccggaaggttgcgcc
atgttctcgctacagcttcacgttcccttggccagcgcccttgggcagagattgcccatg
attcagcatctggtggccgtcgctgtcgtgaaagcgattcgaagcataccaggctatgag
aagcttgatatccgagttaaatggcccaacgatatctatgcaaatggctgtacgaaaatt
ggaggattgatcataaattcgcagctctgcgggatggaagccgttgttaacgtgggctgt
ggcgtgaatctcagcaattcgaaacccacaatgtgcatcaatgatttgatcagggagtac
aacaaacttaaaggcacaagtttgcctttactgggaatcgaacaaacgttggcgtacatc
ttcaatgaaatagatcgaatatacgtttcagtacaggaaaaggacgatttgcaagacctg
tatgatttgtattacaaatattggctacacagtaacagatctgtgatcgtcaaaagcgaa
gacggagaggaaattgctggaacaatctcaggaatcgacgaatatggctttctgttggtc
aatacgaacaaggagggtaaaccgatctgtgttcatcctgatgggaacagtttcgatatg
atgaaaggacttatcattccaaagtactattaa

DBGET integrated database retrieval system