KEGG   Aedes aegypti (yellow fever mosquito): 5571876Help
Entry
5571876           CDS       T01053                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK4
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:aag00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    5571876
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aag01001]
    5571876
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aag03036]
    5571876
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     5571876
Protein kinases [BR:aag01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   5571876
Chromosome and associated proteins [BR:aag03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    5571876
   Centrosome duplication proteins
    Regulators of centriole replication
     5571876
  Sister chromatid separation proteins
   Polo kinases
    5571876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Plk4_PB1 Plk4_PB2 Pkinase_fungal RIO1 POLO_box Haspin_kinase Kinase-like DUF4520
Motif
Other DBs
NCBI-GeneID: 5571876
NCBI-ProteinID: XP_021706353
Position
3
AA seq 905 aa AA seqDB search
MSFGDRIEDYEVYEILGKGGFASVYRARCLGSGTFVAIKMIDKKLMQSSGMANRVRQEVS
IHSQLKHPSILELYTFFEDASHVYLVLELAENGELQRYLRETKKTFNEYEAASVLKQVVD
GLLYLHSHHILHRDMSLANLLLTKQMTVKISDFGLATQLTRPDEKHMTLCGTPNYISPEV
ASRASHGLPADVWGLGCMLYTFLVGKPPFDTEGVKSTLTKVVMSNYTIPPYISSEARDLI
DQLLKKNPAERIKLDQVLQHPFMRKATSYDSYRGGGTLASSDSGLVTMSSNGGSNRSNIP
SSYGQDQRLQAPIIHQMPLRYQPISEHEYDFQESILPQQRPQSASHNKPTSDFFSGISND
PRTMAPSSRPMQHHLNQISLLQQFNSLELMEKYNINKADIASVGRSASEGSSGVLLQEHQ
QQMIQQHAISLLNSKPKSASISMLYQRADSAAGPSSFGEKENYALHRRGDRETPLNPGNY
DFIEHFQPKDNNYPPRSATPKRRSPTKSPKKRLDIPPLNTARLLPNRHKTKNAILSIRSS
GEVVLEFIKFKTRYKENRVVDVCRISSDGLRFVLYHPDGGKGVPIEEEPPDLPPGGADSI
FSYENLPEKHWKKYQYAARFVQMVKAKTPKITYYSEKAKCQLMETLEDYEASFYSGTKII
KSPQDGVKFVDSSGIAIKTIASLSSSQNAEYQHFQQTLEHCLNIERALSAIQTGKTFPLI
IGRRPANAPLTSSSSSSSSSTKENQLYSNISSPNTPQTPHQMPSFAMSTASHTSAGNPLT
QRPVLSSKPVPANFSNVAMKKCTIAGVGTAVQLSQGVVQVQFLDGATLSLIPIEQGGGVT
FSPAVGSPLQHYSTQDNDALLPASLREKIGQMPAILRELNAAPVPSIPFNFLEGSPRTPL
TRFLR
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcggcgatcggattgaggactacgaagtgtacgaaattcttggcaaaggtgga
tttgcaagtgtttaccgtgcaagatgcctgggaagtggaaccttcgtggcgatcaagatg
atcgacaaaaagttgatgcaatcctcggggatggccaatcgagtccggcaggaggtcagt
atccattcccagctgaagcacccgtcaatcttggaactgtacacgttcttcgaggatgcc
agccatgtctatctggttctggagctggccgaaaacggtgaactgcaacggtatctccgt
gagacgaagaagactttcaatgaatatgaagctgcgtcggtcctgaaacaggtggtggat
ggccttctgtatctccattcgcaccacattctgcaccgggacatgtcccttgccaatctg
cttctgacgaaacagatgaccgtcaagatatcggactttggactggccacgcagttgaca
cgaccggatgaaaagcatatgaccctatgcgggactccgaattatatttcgccggaggtg
gcgtcccgggcatcacatggtctaccggccgatgtctggggtcttggttgtatgctatac
actttcctggtggggaaacctcctttcgacacggaaggagtcaagtccaccctgacgaag
gtcgtgatgtccaactacaccattccgccgtacatttcttcggaggcacgggatctgata
gatcaactattgaagaagaaccctgcggagcggatcaagctggatcaggtattgcagcat
ccgtttatgagaaaggccaccagctacgatagctatcgtggcggaggaactctagcttcc
agcgatagcggactcgtaacgatgtccagcaacggaggatccaaccgatccaacatccct
tcgagctacggccaggatcaacggctacaagccccaatcatccatcaaatgcctcttcgg
taccaaccgatcagcgaacacgagtacgacttccaggagagcatcttgccacagcagcga
cctcaatctgcatcgcacaacaaaccaacgtcggattttttctccggcattagcaacgat
cctcgaacgatggccccatcgtcccgccccatgcaacaccatctgaatcagatatccctg
ctgcagcagttcaacagtttggagctgatggaaaagtacaacattaacaaagcggacatt
gccagcgtgggacgatcggcatccgagggcagctcgggagtgcttctgcaggagcatcaa
cagcaaatgatacagcaacatgctatttcgttgctgaattccaaacccaaatcggcttcc
atatcgatgctataccagagagcagatagtgctgctggtccttcgtcgtttggtgaaaag
gagaactatgctcttcacaggaggggtgaccgggaaacgccattgaatccgggaaattat
gatttcatcgaacactttcaacctaaagacaacaactacccaccgcgcagtgccactccg
aagcgcagaagtccaaccaaatcgccgaaaaagcgtctggacataccacctctgaacact
gcccgtttgctccccaatcggcacaagacgaaaaatgccatcctcagcatccgatccagc
ggtgaggtcgtcctggagttcatcaagttcaaaacccgctacaaagagaaccgggtggtg
gacgtttgtcgcatctcgtcggatgggcttcgctttgtgctgtaccatccggatgggggg
aaaggcgttccgatagaggaagaaccacccgatttgccgccgggaggtgccgacagtatt
ttcagctatgagaaccttccggagaagcactggaagaagtaccaatacgcggcccggttc
gtgcagatggtgaaggccaaaacgcccaagatcacgtactacagcgagaaggccaagtgc
caactgatggaaacgttggaggattatgaagcgagtttctatagtggaaccaaaatcatc
aaatcgcctcaggatggcgtcaaatttgtggattccagcggcatcgcgataaagaccatt
gctagtctgagttcatcgcagaacgcagaatatcagcactttcagcagaccctggaacac
tgcctcaacatcgagcgggccctttccgccatccaaaccgggaagaccttcccgctcatc
atcggtcgacgacccgcaaatgctcctcttacatcctcctcctcctcatcctcttcctca
accaaagaaaaccaactctattccaacatctcctctcccaacactccgcaaacgcctcac
cagatgccttcttttgccatgtccacggcgtcccacacttcggcagggaacccgctcact
caacggccagtcctctcgtccaaacccgtgccggccaacttcagcaacgtggccatgaag
aagtgcaccatcgcaggcgtaggaacggccgtccagctatcgcaaggcgtcgtccaggtc
cagtttctcgacggggccaccctttcgttgatcccgatcgagcaaggaggcggagtcacg
ttttccccggccgtgggaagcccactgcagcactattccacccaggacaatgatgcgctg
cttccggcgagtctgcgcgagaaaatcggccaaatgccggcgatcttacgcgaactgaat
gcggccccggtgccgtcgattccgttcaactttctagagggatcgccgcggacaccgttg
acgcggtttttgcgataa

DBGET integrated database retrieval system