KEGG   Aedes aegypti (yellow fever mosquito): 5572106Help
Entry
5572106           CDS       T01053                                 

Definition
(RefSeq) tripeptidyl-peptidase 2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
KEGG Orthology (KO) [BR:aag00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aag01002]
    5572106
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aag03110]
    5572106
Enzymes [BR:aag01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     5572106
Peptidases and inhibitors [BR:aag01002]
 Serine peptidases
  Family S8: subtilisin family
   5572106
Chaperones and folding catalysts [BR:aag03110]
 Intramolecular chaperones
  Subtilisin family
   5572106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPPII Peptidase_S8 TPPII_N
Motif
Other DBs
NCBI-GeneID: 5572106
NCBI-ProteinID: XP_021698409
Position
2
AA seq 1324 aa AA seqDB search
MIYLSLHIGVRRLNSKQILRLQAIPVCQSRHSVGAAAEAIKKLKKMEGAIDVKFPAGSLV
PKNETGALNFVRKYPDYNGTNVTIAILDSGVDPRAKGLEIVPGGDVKVVERYDCSGCGDV
DTSKQVTAAPDGTIVGLSGRVLRLSNVMKTKCPSGEYRIGLKSMHDLYPSRIRDKIVADA
KLKTWDEAHKKAMAEVSREVADFEAKNINAQNLPLREKLNKENLDGTVEFLNACEKKFSD
LKTTYDCVLFSTDDGWMAVIDTTENGDLENAVHVQEYSRAHEMVNLDEFLSISINVHDGG
DVLEIVGMCSSHGTHVASIACGFHPDNPELDGVAPAAKVVSLTIGDGRLGSMETGTALVR
AIIKVMELCEAGRKIDVINMSYGEHGHWSNSGRVGELMSELVNKYGVVWVASAGNHGPAL
CTIGTPPDISQPSCVGVGAYVSPEMMEAEYALRQKLPGNVYTWTSRDPCIDGGFGVTVCA
PGAAIASVPQFTMSKAQLMNGTSMAAPHVAGSVALLISGLKQKNINFTAFSIKRALWNTA
TKIDYVDKFAQGNGLLNVEKAFENLTNYKDCIENYLRFSVSVGGNGAKGIHMRQGLLTKP
EEFNVSIEPVFFNDKYASAADKISFNVRLTLIPTESWIQCGSFLDLCYSQRTICVKVDPT
GLAAGVHRASIKAYDSSCVEKGVLFEIPVTVVQPIVVDPKSLEYTQTEAITCKPNTILRN
FFLVPKYATWAVLEMISADKSDTVGGKFLIHTMQILPMKYCKAQETQKILPVNSVSTTVH
PFKCVGDNILEVCIAKYWSNFGTVPLKYSVKFHGISPLNGNIMHSASGIHRIDLTTLSAE
EVLPSVSLKSAVMILKPSETKITPLTTRDVVHPGRQIYQNVLTYSMHLNKSQEVAFYAPL
FSTVLYESEFESQFWMVFDCNKMMVGCGDAYSNDSFLKLEKGDYTVRLQVRHEKKELLEK
ISETNMLANIKLANALSVDIYKSYNQAIVNGKKITTFAFPAGVTRPIYLAPITNEKLQKA
SFPNQCSWLEGTIVYAKDELGKKCDTHGFQYILTEGPTVKKNGTGSPKENKSKFEEYSEG
LRDYQVAQIAKLDAENAEAVYKTVLKDNPTFVGAHLALIENLDSNDLKMNLPLTFANNLD
KNDKNAAALLKFKLIKIIELAELAMKEIDQNALLAYYGLKTDSRSNAAKIKTQMDKQKQQ
LLDAAQKKLIALSKLRVIKAVVDSNEVGDDGVDQLENIEQLFSDIGKFIDYNDTKVLLSS
IWHAYTLNQYGRMLKYLGKLYEDKLSREIVEEQSRVVSERKWPHIEQLLNKVVVTSNPQG
FRLF
NT seq 3975 nt NT seq  +upstreamnt  +downstreamnt
atgatatatttatcgctgcatattggagttcgaagattgaatagcaagcagattttacgt
ttacaggctatccccgtttgccaaagtcgtcactcagtgggagccgcagcggaggccatc
aagaagctgaagaaaatggaaggggccattgacgtgaagttcccggctggatcgctggtg
ccgaaaaacgaaaccggagcgctgaacttcgtgcggaagtatcctgactacaacgggacg
aatgtgacgattgcgattctggactccggagtggacccacgggccaaggggctggagatt
gtccccggaggagacgtgaaggtcgtcgagcggtacgattgttctggttgtggagatgtc
gacacgagtaaacaggttacggccgctccggatggaacgattgtgggcctgtctggcagg
gttctgcgtttgtccaacgtcatgaaaacgaaatgtccttcgggggaatatcgcatcggg
ctgaagagtatgcacgatctttatccctcgcgtattagggataagattgtcgcagatgcc
aagctgaaaacatgggacgaagcgcacaagaaagccatggcggaagttagccgagaggtg
gctgatttcgaagcgaagaatattaatgcacagaacttgccgctgagagagaaattgaac
aaagagaatctggatggcacggtggagttcttgaatgcgtgtgagaaaaagttctccgat
cttaagaccacttacgactgcgtgctgttctcgactgacgatggctggatggccgtaatc
gataccacggagaatggcgatctggagaatgcagtccacgtgcaagagtacagcagggca
catgagatggtcaatctagacgagtttctgtctatttcgataaatgtccatgatggtgga
gatgtgctggaaattgtggggatgtgctcaagccacggtactcacgtcgcctcaattgca
tgcggttttcacccggacaatccagaactggacggtgttgctcccgcggcaaaggttgtc
tcactgacgatcggtgatggccgattgggatcgatggagactggcactgcgctggtgagg
gcgatcatcaaagttatggagctatgtgaggcaggtcgcaagattgatgtgatcaacatg
agctatggagagcatggccattggtccaattccggacgagtgggagaacttatgagcgaa
ttagtgaacaagtatggcgtcgtttgggttgcctcagctggtaatcatggaccggcactg
tgcaccatcggaactcctccggacataagccagccaagctgtgtgggagttggtgcttac
gtatctcctgaaatgatggaagctgagtatgcactaaggcagaaactgccaggcaacgtc
tacacctggacttcccgggatccttgcatcgacggtggattcggagtgacggtatgtgct
cccggtgctgcgatagcctctgttcctcagtttacgatgtccaaggcacagctgatgaat
ggaacgagtatggcagcaccacatgtcgccggttcagttgctctgttgatttccggcttg
aagcagaaaaatatcaacttcactgcatttagtattaaacgggccctttggaacactgcc
accaaaatcgactacgttgacaaattcgcccaaggaaacggtctcttgaatgtggaaaag
gcatttgagaatttgaccaactataaggattgtatagaaaactatctgagattttcggtc
agcgtgggagggaatggcgccaaaggtatccatatgcgccagggactgctaactaagccg
gaagaattcaacgtcagtattgaacctgtatttttcaacgataaatatgcttccgctgct
gataaaatcagtttcaacgtaagactgactctcattccaacggaatcatggattcagtgc
ggatctttcctagatctgtgctattcacaacgtacaatctgcgtgaaagttgatcccacc
ggtttggctgccggtgttcatagagcaagtattaaagcatacgattcctcgtgtgttgaa
aagggcgtcttattcgagatccctgtaacggttgtgcaaccgattgtggtggatcccaaa
agcctagaatacacgcaaaccgaagctatcacctgtaaaccgaatacgattctgcggaac
ttcttcctggtgccaaaatacgccacctgggccgtgttggaaatgatctcggccgacaag
agtgacaccgtcgggggaaagttcctgatccatacgatgcagatcttgccgatgaagtac
tgcaaggcgcaggaaacgcagaagatattgccggtgaacagtgtttccacgacggtgcat
cccttcaagtgcgtgggcgataatatattggaagtatgtatcgcaaaatattggtccaat
ttcggtacggtaccactgaagtattccgtcaaattccatggcatttctccattgaatgga
aatattatgcatagcgccagtgggatacatcgaattgatctgaccactctgtcggccgaa
gaagtgctcccatcggtgtccctcaaatcagcggtcatgatattgaaaccgtcggaaacg
aaaatcacaccgttgaccacgcgagacgttgtgcacccaggtcgtcaaatctaccaaaac
gtgctaacgtatagtatgcacttgaataaaagtcaagaggttgctttctacgctcctctg
ttcagtaccgtactgtatgaaagtgagttcgaatctcagttctggatggttttcgactgc
aacaaaatgatggttggatgtggcgatgcgtactcaaatgattccttcttgaagctggaa
aaaggtgactatactgtacgcttgcaagtacgtcacgaaaagaaggagctgctagaaaag
atttcagagacaaacatgctggcaaatatcaaattggctaatgcgttgtcggtagacatc
tataaatcgtacaatcaagctatcgtcaatgggaagaagataacaactttcgctttcccg
gccggagttactcgtccaatctatctggctccaatcacaaacgaaaagcttcagaaagcc
tcattcccaaatcagtgctcctggctagaagggacgatagtttatgccaaggacgaattg
ggtaaaaagtgtgacactcatggcttccaatatattctgacggaaggcccaaccgtgaag
aagaatggcaccggcagtcccaaggaaaacaagagcaaattcgaggaatacagcgaaggc
ctccgtgattatcaagtcgcgcagattgccaaactggatgcggaaaacgccgaagctgtc
tacaagactgtactgaaagacaatcccacttttgtgggagctcacttggcgttgatcgag
aatttggatagcaacgacctgaagatgaacctgccgctcacattcgccaacaatttggat
aaaaatgacaaaaatgccgccgcactgttgaagttcaagttgatcaagatcattgaattg
gctgagttggcaatgaaggaaatcgatcagaacgcactactggcatactacggactgaaa
acggacagtagatcgaatgcagcgaaaattaaaactcaaatggacaaacaaaagcagcaa
ttactggacgcagctcaaaagaaactaatagctctatccaaactgcgcgtcatcaaggcg
gttgtggacagcaacgaggtgggggatgacggtgtggatcagctggaaaacatcgagcag
ttgttcagtgacattggaaagtttatcgattacaatgacaccaaggtgctattatcatcg
atttggcatgcatacaccttgaatcagtatgggcgcatgctgaaatacctaggcaaactt
tacgaggataaactttcgcgagaaattgtggaagaacaaagcagagttgtgtccgagcgg
aaatggcctcacatcgagcagctgctgaataaagtggtcgtcacctccaatccacaagga
tttagactgttttaa

DBGET integrated database retrieval system