KEGG   Aedes aegypti (yellow fever mosquito): 5574220Help
Entry
5574220           CDS       T01053                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 4 isoform X2
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00061  Fatty acid biosynthesis
aag00071  Fatty acid degradation
aag01100  Metabolic pathways
aag01212  Fatty acid metabolism
aag04146  Peroxisome
Module
aag_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:aag00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    5574220
   00071 Fatty acid degradation
    5574220
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    5574220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aag01004]
    5574220
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aag04147]
    5574220
Enzymes [BR:aag01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     5574220
Lipid biosynthesis proteins [BR:aag01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   5574220
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   5574220
  Exosomal proteins of breast cancer cells
   5574220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 5574220
NCBI-ProteinID: XP_001661275
UniProt: Q16RD8
Position
3
AA seq 712 aa AA seqDB search
MGNDNMESFWVQTAIGAIKIIAMVYDIITFPVYLVLQRPWKRRALAKRQKAKIIQQDATS
ITYRGVDPPGEMHVKMLQNNIDTLERMFEFVTKVHSTKRCIGTRKIISEEDEMQPNGRVF
KKFNMGDYMWRSFIETEYAAACFGRGLRELGQQPRQNIVIFAETRAEWLIAAHGCFKQNM
PLVTIYATLGDEGIAHGINETEVTTVITSHELLPKFKSVLNITPNVKKIIFMEDQLHKTE
TTGFKEGVEIIPFSTVVEKGEKSKMPGCSPTPDDTAIIMYTSGSTGTPKGVLLSHSNCIG
TMKNFCDIFKIYPDDVLIGFLPLAHVFELLAESVCLLTGVPIGYSTALTLIDSSSKVMKG
CKGDASVLRPTCMTSVPLILDRISKGINAKVNAETPMKKAFFKFAYQYKSKWVARGYQTP
FLDKILFKKIAKLMGGRIRGVMSGGAPLAADTHEQIQLCLCVEMIQGYGLTETTAGAAVT
DKFSMEYNVVGAPSSCNYIRLINWEEGNYRVTNKPYPQGEIVVGGATVSKGYYKLPGKTE
EEFFEEDGQRWFRTGDIGEVHHDGVLKIIDRKKDLVKLQAGEYVSLGKVESELKTCPVVE
NICVYGDSTKQHTVALIVPNPQHLDEIAERQGLKGMEFEELCTSPVMEKAVVQELAEHGK
KCKLHRFEIPTVVTLCKDIWTPDMGLVTAAFKLKRKDIQERYKNEISRMYAS
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgacaacatggaaagcttctgggtgcagacggcgatcggagcgatcaaaatc
atcgccatggtgtacgacatcatcacgttcccggtatacctggtgctgcagcggccctgg
aagcgaagagccctcgccaaacgacagaaggccaaaatcattcagcaggatgccacatca
atcacataccgtggcgtggatccacccggcgaaatgcacgtcaagatgctccagaacaac
atcgacaccctggaacggatgttcgagttcgttaccaaagttcacagcaccaagcggtgc
atcggaacgcgcaaaatcatcagcgaagaggatgagatgcaaccgaatgggcgggtattc
aaaaagttcaacatgggtgactacatgtggagaagtttcatcgagacggaatacgcggcc
gcttgcttcggccggggtctgcgggaactaggccagcaaccacggcagaacattgtgatc
tttgccgaaacgcgggccgaatggctgatcgcggcgcacgggtgctttaagcagaacatg
cccctggttacgatctatgccacgctcggtgacgagggtatcgcgcacggtatcaacgag
acggaagtgacgacggtcatcacctcgcacgaactgctgcccaagttcaagtcggtgctg
aacatcacaccgaacgtgaagaagatcatcttcatggaagaccagctgcacaaaacagaa
accaccgggttcaaggagggagtggagatcatcccgttctcgacggtggtcgagaagggc
gagaagagcaaaatgcctggatgttccccaacacccgacgacacggccatcatcatgtac
acgtccggctctaccggtaccccgaagggtgtcctgctgtcgcactccaactgcattgga
accatgaagaacttctgcgacatcttcaagatctacccggacgatgtgctgatcggattc
ctgcccttggcgcacgtgttcgaactgttggccgaaagtgtgtgcctgctgaccggtgtc
ccaatcggatactccaccgctctgacgctgatcgactccagctcgaaggttatgaagggt
tgcaagggtgatgcctctgtgctgcggccgacctgtatgacgtccgttccgctcatcctg
gatcgtatctcgaaaggaatcaacgctaaggtgaacgccgaaactccaatgaagaaggcc
ttcttcaagtttgcctaccagtacaagtcgaaatgggttgcccgaggttatcagacgcca
ttcctggacaaaattctgttcaagaagattgccaagctgatgggcggacgcatccgcggc
gttatgtccggaggtgcccccctggctgccgatacccacgaacaaattcagctgtgcttg
tgcgtcgaaatgatccagggctacggactgacggaaacgactgccggagctgccgtgaca
gacaaattctccatggagtacaacgtggtgggagcgccttcgtcgtgcaactacatccgg
ctgatcaactgggaggaaggcaactatcgcgtcacgaacaaaccgtacccgcagggagag
atcgtcgtcggtggagcgaccgtttccaagggctactacaaactgcccggcaaaaccgag
gaggaattcttcgaggaagacggccaacggtggttccgcaccggagatatcggcgaggtg
caccacgatggcgtgctcaagattattgatcgtaagaaggatctggtcaagctgcaggcc
ggcgagtacgtatccctgggcaaggtggaatcggaactgaagacctgcccggtggtggag
aacatctgcgtgtacggtgactcgacgaagcagcacacggtggcgctgattgtgccgaac
ccgcagcacctggacgagattgccgagcggcaaggactcaagggtatggagttcgaggag
ctgtgtacgtccccagtcatggagaaggccgttgtgcaggagctggccgaacatggcaag
aaatgtaaactacaccgcttcgagatcccaaccgtggtaacactctgcaaggacatctgg
accccggacatgggcctggtaacggcggcattcaagctcaagcgcaaggacatccaggaa
cggtacaagaacgaaatcagccggatgtacgcgtcgtag

DBGET integrated database retrieval system