KEGG   Aedes aegypti (yellow fever mosquito): 5574315Help
Entry
5574315           CDS       T01053                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: dedicator of cytokinesis protein 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
KEGG Orthology (KO) [BR:aag00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aag04131]
    5574315
Membrane trafficking [BR:aag04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    5574315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N MRP-S25
Motif
Other DBs
NCBI-GeneID: 5574315
NCBI-ProteinID: XP_001655092
UniProt: Q16R48
Position
2
AA seq 2079 aa AA seqDB search
MASSQRAFASKLTKHNSSDIRKNVANYQLLSKSDSSSVCSSSISLCELVEPIDYEEFLTQ
HTNMLIRDPLRAMLDFPVNDVQVKVVPRKIRTLEHVVPKEDLGELPLHVQHCVDCYTRPW
KVVEFAQRNYSSSCNSRERVDKGALSPSSYQQEFEIDRDFFGCASLEESVTSTTLYASES
CTPSSRQSIASLSSVSTCTDTLTPRGSWASFDLRSSVNDPLIPGLLDRVAPETIDQGNEA
KRLEERQQALFSLYPEGDPEDAIEKRLPAEIPMEHLGNRIHVKCLQLKLELEVEPIFASM
AIYDAKERKKISENFYFDMNSESLRRMLVSHVPFADISTQAREAIFDITNPSNELYLVIR
LEKVLQGDIKDSVEPYLKEDKDKYRDKAKSNAADFCDRLGKYRMPFAWTGIYLTNIFNGD
NPENDKDRESMSSASSSNSLDRKSSTSSFDQFRKRATDMGTLTRRGSLERKMEKRRSWSP
DDFANSVETFRPISITVNSFFKQESDKMKDEELYKFLPELKRPGALMKKHKCIPGSIKIE
ISPIPEDLKCALTPELAKIDPYPNDHTRPTKEILEFPSTPILNPHYSYRNILFVSPKELN
FSTRAGSARNIAVRVQLMSGERQFDALPAIFGKSSCPEYTAEAFTAVNYHNKQPTFYDEI
KIALPANLKQNHHILFTLFHVSCQKKPQEIQPTIETPVGYTWLPVLKDGHLNVGEFNLPV
MVEEPPDNYSFIPPDVQLPGTKWLDNHRPVFSVTIDAVTSVHALDDYLDKFIYLCECLDL
RKVPPRIGEGNMEREFKRTLQELQSADQEKLVKNLQVILDKLIELLVTTYRIGGEALSLG
QTIFETICQISDKIFFLQPEDRYGRQNILSTYIQFQCKIPHPLDPKCKLPYARQGAVGSS
DEMTRSSSNPDLHQMNSAYSEMTSSMSGKLVDRTSSMRGEMSPTAGGPKDGLIRLLHEEI
AKNWVVASGSAAELSMTNSWMLFELTIKSMVEHLELTNSLNSPRKSRFPHQFTDDISTLV
HLVTTKVVGYNSSDPKLAQSINSSLAFFIFDLLSIMDRGFVFGLIRTYYKVIMTKSSPTP
EMIHYKLDFLRIICSHEHFVALNLPFGTPYTALSAPCSPTPSVTSNNSQNSYVSAMAGID
KALYAELSVEFRQQHFLVGLVLQELATVLDISNPPLHGKAIRCLRNLLTSHDLDPRYNDV
EARARVAALYIPLLGIIKDAIPQLHTPIAESHDRLNTIGLLEDYQGPSTSIAASTISPEV
AYAISGIRNYSYVQETPKNKTPLSSENTRHLLSCFLWVVKNLEQSTLFKYTLGLSPHRVH
QMLQVLNICIPNFEYRGRKKPTSKRNTSSFRKTPDMKEKLEECIRGTGSARNDLINRRKD
RYSTEKFRWKKDQIRTQFYDSNIKNEAEMEITYYIEGSLATEVCLTILDTLEMVVQVAST
SELHHNLLGTVLKVLLHALSRNQSTLALQNLFASQRSLIFKYHNLLFDEETDSCADLCLL
LLKHCGSQLPSVRSQAAASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSSSFSEQSL
RRALKTILVYAESDTDLQDTSFPEQVQELLFNLHMILSDTVKMKEYQEDPEMLLDLMNRI
AKGYQNSPDLRLTWLENMAXKHMERANHTEAAMCYVHSAALVAEYLSMLESQNHLPVGAV
SFKHISPNALMESAVSDDVLSPGEDGICLGNRFTESGLKALLEEASNSFQIAGMYEAMND
VYKVLIPICEANRDFRKLGQIHGKLQEAFNRIAQLHGKRVFGTYFRVGFYGAKFGDLDQQ
EFIYKEPTLTKLPEIFSRLQNFYADRFGPDVVQIIKDSNAVDTRTLDPEKAYIQITYVEP
YFETYELRYKETYFERNFNIKRFIFATPFTKSGKAHGELHEQCKRKTILTTANHFPYVKT
RIQVVSREQIVLEPIEVAIEDIQKKTAELAAATNQEPADPKILQMVLQGCIGTTVNQGPM
EMALVFLSGIADSTTIPTKHQNKLRLCFKDFSKKCSDALKKNRNLILSDQKDYQKELERN
YARFTERLAPLITISPSQAQGVVAANNGLHNSKLTPLRW
NT seq 6240 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccagtcagcgtgcatttgcctcgaaactgaccaagcacaattcgtcggacatc
cgtaaaaatgtggccaactaccagctgctgtccaagagcgacagcagttccgtctgttcg
tcgtcgatttctttgtgtgagttggtggaaccgatcgattatgaggaattccttacgcag
catacgaacatgctgatccgggatcctttgagggccatgttggactttccggtgaatgac
gtgcaggtgaaggtggtcccgaggaagattcgcaccctggagcatgtggttccgaaggag
gatttgggggagttgcctttgcatgtccagcattgtgtggattgttatacgagaccgtgg
aaagtggtggaatttgcccagaggaattattccagttcgtgcaacagccgggaaagggtg
gacaaaggagcactgagtcccagttcgtatcagcaggagttcgaaatcgatcgggacttt
ttcggatgtgcttcactggaggaatcggtaacttccacgactttgtatgcgagtgaaagt
tgtactccgagtagccggcagtcgattgccagtttgtcctcggtttcaacctgtacggat
accctgacacccaggggatcgtgggcttcctttgatctgagaagttccgtaaatgatccg
ttgattccgggtttgctggacagagtcgccccggaaacaattgatcagggaaatgaagct
aaaaggttggaggaaagacagcaagcgctgttcagtttatatccggaaggggatccggaa
gatgcaatcgagaaacgcctcccagcggagatacccatggaacacttgggcaatcgaatc
cacgtcaagtgtttgcagttaaagcttgagctagaagtagaaccgatctttgcctcgatg
gctatttatgacgccaaggagcgcaagaagatatcggagaacttttatttcgacatgaac
tcggagtcgttgaggcggatgttggtttcccacgttccgtttgcggacattagcactcaa
gcaagggaagctattttcgatattacgaatcccagcaatgagctttacttggtaattcgc
ttggagaaggtgcttcagggcgatatcaaggattcggttgagccctacttgaaggaagat
aaggataagtatcgtgataaggcaaaatcgaatgcggcagacttttgcgatcggttaggc
aaatatcgaatgccttttgcttggacggggatatatctaactaatattttcaatggcgat
aatcccgagaacgataaagaccgggaaagtatgagctctgcttccagttccaacagtctg
gacaggaagtcgtctacaagcagtttcgatcaattccgcaaaagagccactgatatggga
accctaaccaggcgaggatctctggaaagaaagatggaaaaacgaagatcgtggtctccg
gacgattttgccaacagcgtcgagacattccgacccatttcgataacggtcaacagtttc
ttcaaacaggaatccgataaaatgaaagacgaagaattatacaagttcctaccggaattg
aagcgccctggagctctgatgaaaaagcacaaatgcatcccggggtccatcaagatagaa
atctccccaattcctgaagacctcaaatgtgccctcaccccagaactggcaaagatcgat
ccctacccgaacgatcacacgcgaccaacgaaagaaatcctcgaattcccttccacgccg
atcctgaatccacattatagctatcgcaacatactcttcgtatcaccgaaagaactgaat
ttctcgacccgtgccggctccgctcgaaatatcgccgttcgtgtccagctaatgtccggc
gagcgccaattcgacgcccttccagcaattttcggtaaaagttcctgcccggaatacaca
gcggaagccttcaccgccgtcaactatcacaacaagcaaccaactttctacgatgagatc
aaaatcgcactccccgcaaatctgaaacaaaaccaccatatcctgttcaccctgttccac
gtgtcctgccaaaagaaaccacaagaaatccaacccaccatcgaaacacccgttggctac
acatggctcccggtcctgaaagatggtcacctcaacgtcggagaattcaacctcccagtc
atggtggaagaaccccccgacaactattccttcatcccaccggacgtccaactcccggga
accaaatggctcgataaccatcgcccggtcttctccgtcacgatcgacgcggtcacttca
gtccacgccctggacgactacctggacaagtttatctacctttgcgagtgcctggatctg
cggaaggttcccccgcgaatcggcgaggggaatatggagcgggagttcaagagaacgctg
caggagctgcagagtgccgaccaggagaagctggtcaagaatttgcaggtcattctggac
aagctgatcgagctgctggtgacgacgtaccggatcggaggggaggccctctcgctcggg
caaaccatattcgagacgatttgtcagatttcggataagatatttttccttcaaccggaa
gatcgttacggccggcagaacatcctcagcacgtacatccagttccagtgcaagatccca
cacccgttggatcccaaatgcaagcttccttatgcgcgtcaaggtgcggtcggctcgtcg
gatgagatgacacgttcgtccagtaatccggacttgcatcaaatgaactccgcttactcg
gaaatgaccagttcgatgagcgggaaactggttgatcgtacctccagtatgcgtggggaa
atgtctccaacggctggtggacccaaggatggattgatccgattgctgcacgaagaaatt
gccaagaactgggtagtggccagtggatcagcggcagagctgtcgatgaccaattcgtgg
atgttgtttgagctgaccatcaaaagtatggttgagcatttggagttgactaactctttg
aattctcctcgcaaaagccgttttccgcatcagtttacggatgatatttccacgttggtg
cacttggtgacaacaaaggtggtcggttacaacagcagcgatccaaagttggcacaatcg
atcaattccagcttggcgtttttcatcttcgatctactgagtataatggatcgaggattc
gttttcggactgatccgaacgtattacaaagtgatcatgaccaagagttcgccgacgccg
gaaatgattcactacaagctggactttttgagaataatttgcagtcatgagcattttgta
gcgttgaatttgccttttggtactccttacacagctctctcagctccttgcagtccgaca
ccgagcgttacgtcgaacaacagccagaattcgtacgttagtgcgatggctggtatcgac
aaagctctctatgccgaacttagcgtagagtttcggcaacagcactttcttgtaggttta
gtgcttcaggagctagcaacagtcttggatatatcgaatccgcctctgcacggaaaggca
attcgctgcttgcgcaatctacttacttctcatgatctcgatcctcgctacaatgatgtg
gaagcacgagctcgcgtagctgctctctacattcctcttttgggcatcatcaaagatgcc
attcctcaattgcatactccgatcgccgaatcacacgatcgtttgaataccatcggtctg
ctggaagattaccaaggaccttcgacttcaattgctgcttccacgatcagcccagaggtg
gcatatgctatctccggaatccgtaattacagttatgttcaagagacgcccaagaacaaa
actcctttgagcagcgaaaacactcgtcatctgttgtcctgtttcctctgggtggtcaaa
aaccttgagcagagtacgttgttcaaatatacgctcggactcagtcctcaccgggtccat
cagatgcttcaggtgctaaatatttgcattcctaactttgaataccgggggcggaagaaa
cccacttccaaacgcaacacttcaagcttccgaaagacaccggatatgaaggagaaactt
gaggagtgcattcgaggaacgggatccgcccggaatgatctcatcaatagacgtaaggat
cgctactcgacggaaaagttccgctggaagaaagatcaaatccgaacgcagttctacgac
agcaacatcaaaaacgaagcggagatggagatcacctactacattgagggatcgttggca
accgaggtgtgccttaccattctggacacgctggaaatggttgtccaagtggcgtccacg
tcggaattgcatcacaatctgctcggaaccgttttgaaggttttgctccacgctttatct
cggaaccagagcactttggcgctgcagaatctgtttgcctcgcagagatcgctcattttt
aaatatcacaatttgctgtttgacgaagaaacggatagctgtgcggatctgtgcctgttg
ctgctgaagcactgcggatcccagttgccaagtgtgcgatcacaagcggctgcttcgctg
tatctgctcatgagacagaacttcgagattggaaataatttcgcccgcgtcaaaatgcaa
gtgaccatgtcacttagttctttggtcggtaccagctcttcgttcagcgagcaatccctt
cgccgtgcattgaagaccatcctggtgtacgccgagtccgataccgatctacaggacacg
tccttcccggaacaggtgcaagaactgctgttcaacctccacatgatcctgtcggacacg
gtcaaaatgaaggaataccaggaggatccggaaatgctgctcgatctgatgaatcgtata
gccaaagggtaccagaactccccggatcttcggttgacttggctggagaacatggccnag
aagcacatggagcgagcgaatcataccgaggccgctatgtgttacgttcacagtgccgct
cttgtggcggagtatttgagcatgctggaatcgcaaaatcatctcccagtgggagccgtt
tctttcaagcacatatccccaaatgcacttatggaatctgcagtttccgatgatgtttta
agtcccggcgaggacggaatttgcttggggaatcggtttactgaaagtggcctcaaagca
ctacttgaagaggcttccaattccttccagattgccggaatgtacgaagcgatgaatgat
gtctacaaggttttgatacccatttgtgaagcaaatcgagacttccgtaagcttggccag
attcacggtaagctacaggaagcattcaatcgcattgcacagttacatggcaagcgagtt
tttggcacctatttccgagttggtttctacggagccaagtttggtgatctggatcagcag
gaattcatctacaaagaaccaacgctaacgaaactgccggaaatattcagtcgcttgcaa
aacttctacgccgaccgctttggaccggatgtagttcagattatcaaggattcgaacgca
gttgatacaagaacgctcgatccagagaaagcatacattcaaataacttacgttgaaccg
tactttgaaacctatgaattgcgatacaaggaaacgtactttgaaaggaactttaatata
aagcgcttcatttttgcaactccgttcacaaaatccggcaaggctcacggcgagttgcac
gagcagtgcaagcgaaaaaccatcctaaccacagcgaatcacttcccgtacgtgaagaca
cgtatccaggtggtgagccgggagcaaattgtcctagaaccgatcgaggtcgccatcgaa
gacattcagaaaaagactgccgagttggccgccgccaccaatcaggaaccggcggatccg
aaaattttacaaatggtattacagggttgcatcggtaccaccgtcaatcagggcccgatg
gaaatggcgctggtcttcttgtccggcatcgcagacagcacaaccattccgacgaagcac
cagaacaagctgcggctgtgctttaaagatttctccaaaaagtgttccgatgcgttgaaa
aagaatcgcaatctgattctttccgaccagaaagactatcagaaggagctggagcgaaat
tacgctcgttttaccgaacggctggccccattgatcacgatcagcccctcgcaagcacaa
ggggtggtagctgccaacaatggactgcacaatagtaagttaacgccgttgagatggtaa

DBGET integrated database retrieval system