KEGG   Aedes aegypti (yellow fever mosquito): 5574680Help
Entry
5574680           CDS       T01053                                 

Definition
(RefSeq) atrial natriuretic peptide receptor 1 isoform X1
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00230  Purine metabolism
aag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5574680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aag01001]
    5574680
Enzymes [BR:aag01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     5574680
Protein kinases [BR:aag01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   5574680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 5574680
NCBI-ProteinID: XP_021701637
Position
2
AA seq 1189 aa AA seqDB search
MHGKPFHFPVILLLLCQYCVLSFCIRGKPPSSSGLAPEDSDVAMLLNNLSDSVRERPDEV
SYFEEDELGLSIVMGAAGSNIGHRAAKRSADWINRIEVQDDDISANYIVYNVGVLMASHL
DSPFDLERCGPAVDLALDFINDFLGKTHSIKLKKVQASYASCSGAKSPGLAADMHFKNNV
VAFIGPACAFALEPVARLADYWNTPIITGMGDQPPSEGELSVTSGILGRLSNKWKNESTG
IFKDKSKYQTLTRMSYCQCRLKLVFSSIFHTFDWRHIALILDRSDLFSLTVGKNLEYGLK
EEDLLTCVRELDGNDEEDLDNYLRDVSMYARVIILSVRGSLVRKFMLSAHRLGMTRGEFT
FLDVEIFQSSYWGDHYWELGDEDDQTARKAYEALLRVSLLQPTSPSYQIFADQVRIRAKR
DYNYTFVEDEEVNFFIGAFFDGVYLLGMALNETLTEGGNIRDGTAITRKMWNRSFDGITG
NVRIDDNGDRDADYSILDLDPITGRFEVVAHYYGRTRAYSPVKGKRIHWPGGREGPPPDV
PKCGFLGTSPSCQGSEIILIYALIGFGIISAFGAAVTYILCKQMKLNNELNNMSWRVRPD
EVLLEVGRLFGSKMGLQKLNYENFSLQQFGSSGRASISSGHSQLPAQLFTTIGIYKGERV
AIKKVAKKKVYITSTLLWEIKQARDVSHENTVRFVGACIDLPRPTILILTEYCPKGSLKD
VLENEAIQLDWNFRMSLIHDVVKGMAYLHNSDVGVHGKLRSCNCLIDGRFVLKISDFGLR
TLTTPSEFVRDQNYYNKLSFPELLWVAPELLPTTVIPGTPATQKGDVYSFAIILEEIVVR
GGPYETARQFMDPQQIAERVAAHESPPFRPFVGQRDCPPDLLDLMEKCWSDSPDDRPSFI
QIKSTVKLIMKGFCENLMDDLLRRMEQYANNLESLVEEKTEQLSMEKRRTEELLYQVLPR
PVAQQLLAGEMVQPEQFECVTIYFSDIVGFTALCAQSRPMEVVDFLNDLYSTFDRIIEFY
DVYKVETIGDAYMVVSGLPERNGHDHAREIGLMSLAILDAVKSFTIKHKPEQQLKIRIGI
HSGPVCAGVVGQKMPHYCLFGDTVNTASRMESTGHPLKIHVSEAAKQILDKFGTFRLELR
GEVELKGKGICTTFWLLECSEPDPRPPTPMKNYIDNDVPFPILFPAIGK
NT seq 3570 nt NT seq  +upstreamnt  +downstreamnt
atgcatgggaaacccttccattttccggtgattctactgctcctgtgccagtactgtgtc
ttatcattttgcatacgaggtaaaccaccatcctcctccgggttggcgccggaagactcc
gatgtagccatgctgttgaataatcttagcgattcggtgagagaacggccagatgaggtg
tcgtacttcgaagaggacgagctgggattgtcgattgtgatgggggcagctggaagcaat
attggtcatcgggcagccaaacggtcggccgattggattaatcgcatcgaggtacaggac
gacgatatcagtgctaattacatcgtatacaacgttggagtgctaatggcatctcatttg
gattcgccattcgatttggaacgatgcggaccagcagtagacttagcgttagattttata
aacgattttttgggaaagacacatagcatcaaactgaagaaagttcaagcaagctacgcc
tcctgctcgggagccaaatcgcccggccttgcggcggatatgcacttcaagaacaacgtg
gtggccttcatcggacctgcatgtgcctttgcgttggaaccggtggcccgactggccgac
tactggaatacacccatcatcactggaatgggcgaccagcccccatcggaaggtgagctc
tcggttacatccggaatcctgggacgtttgagtaataaatggaaaaacgaaagcacggga
atattcaaggacaaatccaaatatcagacgttgactcgcatgtcgtactgccagtgtcgc
ctgaagctggtgttctcgagcatttttcacacgttcgactggaggcacattgccctgata
ttggatcggtcggatttgttttcactgacggtgggaaagaatctcgagtacgggctcaag
gaggaagaccttctgacctgcgtgcgggaactggatggtaacgacgaagaggacctggat
aactacttgcgggatgtgagcatgtatgctcgagtgattatcttgtccgtgaggggcagt
ttggtgcgaaagttcatgctctccgcccaccggctcggtatgacgaggggtgagttcacg
tttttagatgtggaaatcttccaaagctcctactggggcgaccactactgggaattgggc
gatgaagacgaccaaactgctcggaaggcgtatgaagccctgctgagagtctctttgctt
cagcccacgagcccctcgtaccagattttcgccgaccaggtgagaattcgtgccaaacgg
gactacaattacacctttgtggaggacgaggaggtgaactttttcatcggagcctttttc
gatggtgtttacctgctgggtatggcgctgaacgagacactgactgagggcggcaatatt
cgagacggaacggccatcactcggaagatgtggaacagaagcttcgacggcattactgga
aacgtgcgaatcgacgacaatggagatcgggacgcagattactccattctcgacctggac
cccattaccggacgcttcgaggtggtagcccattattacggacgaacaagagcttactct
ccggtgaagggcaaacgaatccactggccaggtggccgggaaggtcctccacccgatgtt
cccaagtgtggatttttgggaacatcaccgtcgtgccaaggaagcgaaataattctcatc
tacgcgttgatcgggtttgggataatatctgcgttcggcgccgccgtcacgtacattctt
tgcaagcaaatgaagttaaataacgaactgaacaacatgtcctggcgggtgcgcccggat
gaggttctactggaagtaggacgacttttcggcagtaaaatgggactgcagaagttgaac
tatgagaatttttccctccagcaattcggaagctccggtcgtgcgtccatttccagtggc
cactcccaattgccagcccagttgttcaccactatcggcatctacaagggtgagcgagtt
gccatcaaaaaggtagccaaaaagaaggtttacataacctcaacgctgctctgggaaatc
aaacaagcccgagacgtaagccacgagaatacagttcgctttgtgggcgcatgcatcgat
ctaccgaggccgaccattctgatattgaccgaatactgtccgaaaggtagtctcaaggat
gttctggaaaacgaagccattcagctggattggaatttccgaatgtcgttgattcatgat
gtcgtcaaaggaatggcgtatcttcacaacagtgacgttggagttcatggaaagctacgg
tcctgtaactgtctgatcgatggccgatttgttctgaagatctccgattttggacttcgt
actctgacgactccgtcggagtttgtgcgggatcaaaactactacaacaaattgagtttt
ccagagttactgtgggtagcacccgagctgcttccgacaacggtgatcccaggaacgccg
gcaactcagaagggagatgtctactcgtttgcgatcattctggaggagatcgttgttcga
ggtggaccgtacgagacggctcggcagtttatggacccacagcagattgcggaaagagtt
gcagctcatgaaagccctccttttagaccttttgttggccagagagactgtcccccggat
ttgctggatctaatggagaaatgttggtcggatagtccagacgatcgtccaagtttcatt
caaataaagagcacggttaaactgattatgaaaggtttttgcgagaatcttatggacgac
ttgctgcgtcgtatggagcagtacgccaacaatttggaaagcttggtcgaagagaaaacc
gaacagctcagtatggagaaacggcgtaccgaagagcttctgtatcaggttctaccgagg
ccggtggcacagcaacttcttgccggggaaatggtccaaccggagcagttcgaatgtgtc
acaatctatttcagtgatattgtaggctttacggcactttgcgctcaaagtcgaccaatg
gaggtcgtcgacttcctgaacgatttgtacagcactttcgatagaataattgaattttac
gacgtttacaaggtggaaaccatcggagatgcctacatggtggtatcgggacttccggag
cgaaatggacacgatcatgcgcgggaaatcggtttaatgtcgttggcgattttggatgcg
gtaaagtcattcacaatcaagcacaaacctgaacagcagctgaagattcgtattgggatc
cattcgggaccggtttgcgctggagttgttgggcagaaaatgcctcactattgtttgttc
ggtgatacggttaatacggcatcgaggatggaatctactggacatccattgaaaattcat
gtgtctgaggcggctaaacaaatcctagacaaatttggaacttttcgattggaattgcga
ggagaagttgaacttaaaggaaaaggaatctgcacaacgttttggttattggaatgttct
gaaccagatccaaggcccccaacaccgatgaaaaactacattgataatgatgttccattt
ccgattctcttcccggcaatcggaaaataa

DBGET integrated database retrieval system