KEGG   Aedes aegypti (yellow fever mosquito): 5574905Help
Entry
5574905           CDS       T01053                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00010  Glycolysis / Gluconeogenesis
aag00562  Inositol phosphate metabolism
aag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5574905
   00562 Inositol phosphate metabolism
    5574905
Enzymes [BR:aag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     5574905
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     5574905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DIM1
Motif
Other DBs
NCBI-GeneID: 5574905
NCBI-ProteinID: XP_001661709
UniProt: Q16PV9
Position
2
AA seq 457 aa AA seqDB search
MTDIHLFIFTIVMIVSAVQPFQFKSSRCCEDYCYSLDQDRSQSKHYGTKTAYEVIRGPES
SQEHVVPNCSPSKFWLLARHGTRLPGKKDIESLPPVLNGLRESILANYDTRYKRFKREHL
CPEDVGLLRNWQWDRNITVAYESVLTDQGWDDLKLLAMREKDRFFEILSGPYDEQRYLFK
HTNSQRTEASFKAFVEGLFGNELYDSIPTKPDSSDDVLLKPYDFCPAYDANEDKISEPDS
ELSKFLRSPLYINTLADISTRLGFRQSLSSEQVEAMWNACRFEQAWNLQLPSPWCSVFTK
GQVQVMEYKEDLNYYYQNGYGSEVGSDLSCHAMADMLKHLGRVDGEQVIAYFTHDSAIQL
FLVALGAMEDREALRADNYYAMEDRNFRSSELAPFAANIAVVRYECEDSEEPEKVMFFLN
EKSLKFDWCTEGICDWSEVIRRYERFIDGDCAEMYCR
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatacatctctttatttttacgatcgttatgatcgtatctgccgttcagccc
ttccagttcaaaagtagcagatgttgtgaggactactgctacagtttggatcaagaccga
agtcaatcgaagcactatggcaccaaaacggcttacgaagttattcgtggaccggaatcc
agtcaagagcatgtcgttcccaactgcagtccatccaagttttggttgcttgctcgtcac
gggaccagactgccgggcaaaaaggatatcgagtctctgccccccgttctgaatggtctt
cgagagtcgattcttgctaactacgacacccgctataaaagattcaaaagggaacacttg
tgcccggaagacgtaggcctattgagaaactggcaatgggatcgaaacataaccgttgcg
tatgaatcggttcttaccgatcaaggatgggacgatttgaagttgttggctatgcgagag
aaagatcgcttcttcgagatattgagcgggccttatgatgaacaacgatatctgttcaaa
catacaaattctcagagaactgaagcaagtttcaaggcttttgtcgaaggtttgtttgga
aacgaactgtatgactctatacccacaaaaccagattcgagtgacgatgttctgttgaaa
ccatacgatttctgcccggcatatgatgcgaacgaagacaaaattagcgaaccggattcg
gagttgagcaaattcctaaggtccccgctgtatataaataccttggccgacatctccacg
cgtttaggattccgacaaagtttgagttccgaacaggtcgaagccatgtggaatgcttgc
aggttcgagcaggcttggaatctacagcttccaagcccttggtgtagtgtcttcaccaag
ggtcaggtgcaggtcatggagtacaaggaagatctaaattactactaccagaatggttac
ggatccgaggtggggtccgacctgtcctgccatgcaatggccgacatgttgaaacacttg
ggacgggtggatggtgagcaggttattgcatacttcacgcacgattcggctattcaactc
tttctggttgcgttgggtgccatggaggacagggaagctctacgggcggataactattac
gccatggaagatcggaacttcagatccagcgagctggctccatttgcggcgaatattgcc
gtcgtccggtatgagtgcgaagatagcgaagagccagagaaggtaatgttcttcctgaac
gagaagtctttgaagttcgattggtgcactgaaggcatttgcgattggtctgaagtgatt
cgtcggtatgaaagattcatcgatggagactgtgccgaaatgtactgcagataa

DBGET integrated database retrieval system