KEGG   Aedes aegypti (yellow fever mosquito): 5575634
Entry
5575634           CDS       T01053                                 

Definition
(RefSeq) protein takeout
Organism
aag  Aedes aegypti (yellow fever mosquito)
SSDB
Motif
Pfam: JHBP DUF2883 Peptidase_C23
Other DBs
NCBI-GeneID: 5575634
NCBI-ProteinID: XP_001655779
UniProt: Q16NI1
Position
3
AA seq 248 aa
MKVMVSGTVAVLLMAALATTYAAQFPAGYTLCPKDDQKCLFERIGATFAKHAAGIPAIDL
VSLDPLKIQKMDIVQGGDGPINIVLNFKNVDLTGLSEAVVKKANGFTANPTKMELGILVP
VTSLVGGYKINGKVLILPIQGEGRSNMTMENNHIQMKWTGKLVDRNGKQYYQLDKLKATF
DTTRFHMHFSNLFNGDKALGDNMNVFLNENWQDILMELKPAIIDAFVKIFQSVISGVFNK
VPYNELFQ
NT seq 747 nt   +upstreamnt  +downstreamnt
atgaaggtcatggttagtggaacagttgctgtgctgctgatggcggcgttggcgacaacc
tacgcagcgcaattccccgccggttacacactttgccccaaggacgatcagaaatgtctg
ttcgaaaggatcggtgcgacatttgccaagcatgccgccggtattcccgccatcgacttg
gtctcacttgacccgctgaagatccaaaagatggacatcgtccagggtggcgacggaccg
atcaacattgtgctcaacttcaagaacgtggacctgaccggtctgtcggaggccgtcgtc
aagaaggccaacggattcaccgccaaccccaccaagatggagctgggcattctggtgccg
gtcacgagcctggtcggtggatataaaatcaacggcaaggtgctgattctgcccatccag
ggagaaggccggagcaatatgaccatggagaacaaccacatccagatgaagtggaccggc
aagctggttgaccggaacggcaaacagtactaccagctggacaagctgaaggccaccttc
gacacgacccggttccatatgcacttctccaacctcttcaacggcgataaagctctcgga
gacaacatgaacgtgttcctgaacgagaactggcaggacatcctgatggaactgaaaccg
gccatcatcgatgccttcgtgaagatcttccagtcggtgatatcgggcgtattcaacaag
gtgccttacaacgaactgttccagtaa

DBGET integrated database retrieval system