KEGG   Aedes aegypti (yellow fever mosquito): 5578213Help
Entry
5578213           CDS       T01053                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K22329  tyrosine decarboxylase [EC:4.1.1.25]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00350  Tyrosine metabolism
aag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    5578213
Enzymes [BR:aag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.25  tyrosine decarboxylase
     5578213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 5578213
NCBI-ProteinID: XP_001656857
UniProt: Q17F96
Position
2
AA seq 639 aa AA seqDB search
MDSREFRRRGTEMVEYICNYLETLEQRRVTPSVEPGYLRHLLPGEAPEEPEPWEKIMEDV
ESKIMPGVTHWQHPRFHAYFPSGNSFPSILGDMLSDGIGCIGFSWAASPACTELETIVLD
WLGKAIGLPDHFLALKPGSKGGGVIQTSASECVLVTMLAARAQAIKYLKQQHPFVEEGHL
LSKLMAYCSKEAHSCVEKAAMICFVKLRILEPDENCSLRADTLVKAMEEDEQQGLIPFYV
STTLGTTGSCAFDDINEIGEALQRFPSVWLHVDAAYAGNSFICPELKYLLKGIDYADSFN
TNPNKWLLTNFDCSTLWVRDRIRLTSALVVDPLYLKHGYSDSAIDYRHWGVPLSRRFRSL
KLWFVLRSYGITGLQNYIRHHIDLAKRFERLVLKDNRFEVCNDVKLGLVCFRLKGSDRIN
EKLLSSINASGKIHMVPASVNERYVIRFCATAQNAMVEDIDYAWDVITDFAAEILEKEQA
DEVTEIVDRRKTHTLAQKRSFFVRMVSDPKIYNPAINKAQTPRISTEVTSPSADGTVVTV
QSPKTPGSASWISWPLAFLFTNSDDGPKNDMPLRFRHLDTMVRLSASRRNSATGGASSPS
PEGENGIVLAKSPKRSPIMVRRRGTSPSNQPNAGNGSTK
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggacagccgggagtttcgccgtcgcggtaccgaaatggtcgagtacatttgcaactat
ctggaaacgttggagcagcgccgggtaacgcccagtgttgaaccgggatatctacggcat
ttgctgcctggtgaggctcccgaggaaccggaaccgtgggagaagatcatggaggacgtc
gagagtaaaatcatgcccggcgtgacacactggcagcatccacggttccatgcgtacttt
ccgtcgggcaattcgttcccgtccattttgggcgatatgctgagcgacgggatcggatgc
atcgggttctcgtgggctgccagtccggcctgtaccgagctggagacgatcgtgctggat
tggttgggcaaagcaatcggactgccggatcactttctagcgctgaaaccgggcagcaaa
ggaggcggtgtcattcagacatctgcttcggaatgcgtcctggtgactatgttggcagct
cgagcgcaggccatcaaatatctcaagcagcagcatccgttcgtcgaagaaggccatctg
ctgtccaaattgatggcctactgctccaaggaggctcacagctgcgtggagaaggctgct
atgatctgtttcgtaaagttaaggattttggagccggacgaaaattgctccctccgggct
gatacgctagttaaggccatggaggaggacgaacagcagggactgattcctttctacgtg
tccactaccttgggcactacgggatcctgtgcatttgacgatatcaacgaaataggggag
gctttgcagcgatttccaagcgtttggttgcacgtggacgccgcgtacgccggaaattcg
ttcatctgtccggagttgaagtatttgctgaagggaatcgattacgccgattcgttcaac
acaaacccgaacaaatggctgctgacgaactttgactgttcgacgttgtgggttcgcgat
aggattcgattaacttcagctttggtggttgaccctctctacctgaagcatggatattcg
gactcggcgatcgactatcgtcactggggtgtaccgttgagtcgccgctttagatcactg
aaactatggttcgtactgcgaagttatggtattaccggacttcagaactacattcgacat
cacatcgatctggcgaaacggttcgagcggttggtcctgaaggacaatcgcttcgaggtg
tgcaacgacgtcaaacttggactggtgtgtttccgactgaaggggtcggatcggatcaac
gagaagttgctgagtagtatcaatgcatctgggaaaattcatatggtgccggcttcggtt
aacgagcgatatgtgattcggttctgtgctacggcgcagaatgccatggtggaggatatt
gattacgcttgggacgtcattaccgactttgcagcggagatcctcgagaaggagcaagcc
gacgaggtgacggagatcgtggatcgccgcaagacccacaccctggcccagaagcgatcg
ttcttcgtccgcatggtgagcgatccgaagatctacaatccggccatcaacaaggcgcaa
actcctcgcatttccacggaagtcacgtccccgtctgccgacgggacggtcgtaaccgtg
cagtcaccaaaaactcccggatctgcttcctggatcagttggcctttggcattcctgttt
actaactccgatgatgggcccaaaaatgatatgccactgagattccgacatctagacacc
atggtacggctgtccgcgtctcgtcgtaattcggccacaggaggagcgtcgtccccatca
ccggaaggcgaaaatggtattgttctagcaaaatctcctaaacgttcgccgatcatggta
cggagacgaggcacgtcacccagcaatcaacccaatgccggaaatggatcaaccaagtaa

DBGET integrated database retrieval system