KEGG   Aggregatibacter actinomycetemcomitans HK1651: CF65_00377Help
Entry
CF65_00377        CDS       T03184                                 

Definition
(GenBank) acetyl-CoA acetyltransferase, putative
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aah  Aggregatibacter actinomycetemcomitans HK1651
Pathway
aah00071  Fatty acid degradation
aah00280  Valine, leucine and isoleucine degradation
aah00310  Lysine degradation
aah00380  Tryptophan metabolism
aah00620  Pyruvate metabolism
aah00630  Glyoxylate and dicarboxylate metabolism
aah00640  Propanoate metabolism
aah00650  Butanoate metabolism
aah00900  Terpenoid backbone biosynthesis
aah01100  Metabolic pathways
aah01110  Biosynthesis of secondary metabolites
aah01120  Microbial metabolism in diverse environments
aah01130  Biosynthesis of antibiotics
aah01200  Carbon metabolism
aah01212  Fatty acid metabolism
aah02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CF65_00377
   00630 Glyoxylate and dicarboxylate metabolism
    CF65_00377
   00640 Propanoate metabolism
    CF65_00377
   00650 Butanoate metabolism
    CF65_00377
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CF65_00377
   00072 Synthesis and degradation of ketone bodies
    CF65_00377
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CF65_00377
   00310 Lysine degradation
    CF65_00377
   00380 Tryptophan metabolism
    CF65_00377
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CF65_00377
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CF65_00377
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CF65_00377
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aah04147]
    CF65_00377
Enzymes [BR:aah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CF65_00377
Exosome [BR:aah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CF65_00377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHN70976
UniProt: X2JRN7
Position
253182..254363
Genome map
AA seq 393 aa AA seqDB search
MENIVIVSAVRTPIGSFNGSLAAVSAVDLGATVIKEVIKRADIDSALVNEVIMGNVLQAG
IGQNPARQAALKAGVAKGIPSYTVNKVCGSGLKSVALGVQAIASGDADIVAAGGMESMSQ
APYILDHKIRSGVRMGNLPLRDSMIEDGLTCAINHYHMGITAENIAEQYGISREEQDQLA
LRSQTLASQAVQNGVFDKEIVSVTVKTRKGDIVVSRDEYPKPDTTAEGLAKLRPAFKKDG
TVTAGNASGINDGAAALLLMSESKANALGLKPLARIRGYASAGVDPAVMGLGPVPATQKA
LRKAGLTLDDIDLIEANEAFASQFLGVGRELHFNMEKTNIHGGAISLGHPIGASGARILV
TLLHNLIEKDKKLGLATLCIGGGEGISVIVERI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatcgttatcgtcagcgcggtcagaacgccgatcggcagctttaacggcagt
cttgccgccgtcagtgcggttgatctgggcgctaccgtgatcaaagaagtgatcaagcgc
gcagacatcgacagcgccttggtcaacgaagtgattatgggtaatgtgctgcaagccggt
atcggacaaaaccctgcccgtcaagctgcactcaaagcgggcgtggcgaagggaattccg
tcctacactgtcaataaagtctgcggttcgggcttaaaaagcgtggcgttgggcgtgcaa
gccattgccagcggcgacgccgacatcgtggcggccggcggcatggaaagtatgagccaa
gcgccgtacattctggatcataaaatccgttccggcgtcagaatgggcaatctgccgttg
cgcgacagcatgatcgaagacggtctgacgtgcgccataaaccattaccacatgggcatt
acggcggaaaatatcgccgaacaatacggtatcagccgtgaggaacaggatcagcttgcg
ctgcgttcgcaaacccttgcctctcaagcggtgcaaaacggcgtattcgacaaagaaatc
gtatctgtcaccgtgaaaacccgcaaaggcgacatcgttgtctcccgcgacgaatacccg
aaacccgacaccacagcggaagggctggcgaagttaagaccggcattcaaaaaagacggc
accgtcaccgccggtaacgcctccggtattaacgacggcgccgccgcgttattgttaatg
agcgaaagcaaagcgaacgcattaggactgaaaccgctcgcccgtatccgcggttacgcc
agtgcaggagtcgatcctgccgtgatgggattggggccggtgccggcaacccagaaagcg
ctgcgcaaagcgggattgacgctcgacgatattgacctgatcgaagcgaacgaagccttc
gcctcgcaattcctcggcgtcggcagagaactgcatttcaatatggagaaaaccaatatc
cacggtggtgccatctcgctgggtcaccctatcggcgccagcggcgccagaattctggtg
acgctgctgcacaatctcattgagaaagacaaaaagctcggtctggcgaccctgtgtatc
ggcggcggggaaggcatttcagtgattgtcgaacggatctga

DBGET integrated database retrieval system