KEGG   Aggregatibacter actinomycetemcomitans HK1651: CF65_00964Help
Entry
CF65_00964        CDS       T03184                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP),putative'
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
aah  Aggregatibacter actinomycetemcomitans HK1651
Pathway
aah00010  Glycolysis / Gluconeogenesis
aah00020  Citrate cycle (TCA cycle)
aah00620  Pyruvate metabolism
aah01100  Metabolic pathways
aah01110  Biosynthesis of secondary metabolites
aah01120  Microbial metabolism in diverse environments
aah01130  Biosynthesis of antibiotics
aah01200  Carbon metabolism
Module
aah_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CF65_00964
   00020 Citrate cycle (TCA cycle)
    CF65_00964
   00620 Pyruvate metabolism
    CF65_00964
Enzymes [BR:aah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     CF65_00964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AHN71428
UniProt: X2JNA9
Position
complement(672812..674428)
Genome map
AA seq 538 aa AA seqDB search
MTDVNDVVKELEAIGIHNVKEVVYNPSYEQLFEEETKPGLEGFEKGTVTTTGAVAVDTGI
FTGRSPKDKYIVLDDTTKDTVWWTSDAAKNDNKPMTQETWASLKDIVTKELSGKRLFVID
GFCGASEKDRIAVRIVTEVAWQAHFVKNMFIRPTDAELKDFKPSFVVMNGSKCTNPNWKE
QGLNSENFVAFNLTERIQLIGGTWYGGEMKKGMFSMMNYFLPLKGVGAMHCSANVGKDGD
VAVFFGLSGTGKTTLSTDPKRELIGDDEHGWDDVGIFNFEGGCYAKTIHLSEENEPDIYR
AIRRDALLENVVVRADGSVDFDDGSKTENTRVSYPIYHIDNIVKPVSRAGHATKVIFLTA
DAFGVLPPVSKLTPEQTKYYFLSGFTAKLAGTERGITEPTPTFSACFGAAFLTLHPTQYA
EVLVKRMQAAGAEAYLVNTGWNGTGKRISIKDTRGIIDAILDGSIEKAQMSELPIFNLAI
PKALPGVDPAILDPRDTYADKAQWEAKAKDLAGRFVKNFEKYATNAEGKALISAGPKA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgtaaacgacgtagttaaagaacttgaggcaattggtattcataatgtaaaa
gaagtggtttataacccaagttatgaacaactttttgaagaagaaaccaaaccgggcttg
gaaggtttcgaaaaaggcaccgtcaccaccaccggcgcggtcgctgtggataccggcatt
tttaccggacgttctcctaaggataaatatattgttttagatgacaccaccaaagacacc
gtatggtggacttccgacgcggcgaaaaacgacaataaaccgatgacccaagaaacctgg
gcaagcttaaaagacatcgtcaccaaagagctttccggcaaacgcttattcgtgattgac
ggtttctgcggcgccagcgaaaaagaccgtattgcggtgcgtatcgtgactgaagtggca
tggcaggcgcatttcgtgaaaaatatgtttattcgtccgaccgacgccgaattaaaagat
ttcaaaccaagtttcgtggtgatgaacggttctaaatgcactaacccgaactggaaagaa
caaggcttgaattccgaaaacttcgtagcgtttaacttaaccgaacgcattcaattaatc
ggcggcacctggtacggcggcgaaatgaagaaaggtatgttctctatgatgaactacttc
ctgccgctaaaaggcgtgggcgcaatgcactgttccgctaacgtaggcaaagacggtgat
gttgctgtgttcttcggcttgtccggcaccggtaaaaccaccctttctaccgatccgaaa
cgtgagctaattggtgatgatgaacacggttgggatgatgtgggtatcttcaactttgaa
ggtggttgttacgcgaaaaccattcacctttccgaagaaaacgaaccggatatttatcgc
gcaatccgtcgtgatgccttattagaaaacgtagtggtgcgtgcagacggttcagtggat
ttcgatgacggttccaaaaccgaaaacacccgcgtttcctatccgatttatcacatcgat
aacatcgttaaaccggtttcccgcgcaggtcacgctactaaagtgattttcttaaccgct
gacgctttcggcgtgttgccgccggtatctaaattgacaccggaacaaaccaaatactac
ttcttatccggtttcactgcgaaattagccggtaccgaacgtggtattaccgaaccgacc
ccaacattctccgcttgtttcggtgcggcattcttaaccttacacccaacccaatatgcg
gaagtgttggtaaaacgtatgcaagcggcaggtgcggaagcctatttggtgaacaccggt
tggaacggcacgggcaaacgtatctccattaaagatacgcgcggtattatcgacgccatc
ttagacggttctatcgaaaaagcgcaaatgagcgaattaccaatcttcaatttggcaatt
cctaaggcattacccggcgttgatccggctattttagatccgcgtgatacttatgccgat
aaagcgcaatgggaagccaaagcgaaagatcttgctggtcgttttgtgaagaatttcgaa
aaatacgctaccaatgcagaaggtaaagccttaatttctgccgggcccaaagcgtaa

DBGET integrated database retrieval system