KEGG   Aggregatibacter actinomycetemcomitans HK1651: CF65_02195Help
Entry
CF65_02195        CDS       T03184                                 

Definition
(GenBank) oxaloacetate decarboxylase alpha subunit,putative'
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
aah  Aggregatibacter actinomycetemcomitans HK1651
Pathway
aah00620  Pyruvate metabolism
aah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CF65_02195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aah02000]
    CF65_02195
Enzymes [BR:aah01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     CF65_02195
Transporters [BR:aah02000]
 Other transporters
  Primary active transporters [TC:3]
   CF65_02195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23 DUF5525
Motif
Other DBs
NCBI-ProteinID: AHN72373
UniProt: X2JQV5
Position
1494641..1496437
Genome map
AA seq 598 aa AA seqDB search
MTKKIKVTELVLRDAHQSLFATRLRLDDMLPIAHELDDIGYWSLEAWGGATFDSCIRFLG
EDPWVRLRELKKACPKTPLQMLLRGQNLLGYRHYADDVVERFVERCVANGMDVFRVFDAL
NDPRNMKAALQAVRKFGGHAQGTLSYTTSPVHTMQTWLDTTEQLLEIGIDSLVIKDMSGI
LNPMAAAELVREIKKRFDVELHLHCHSTTGMAEMALLKAIEAGVDGVDTAISSMSATYGH
PATESIVATLQGTEYDTGLDIPRLEKIAAYFRNVRKKYAKFEGQLRGVDSRILVAQVPGG
MLTNLENQLKQQNASDKLDLVLEEIPRVRKDLGYIPLVTPTSQIVGTQSVINVLTDERYK
TIAKETAGILKGEYGKTPAPVDSALQARVLEGAAPMTDRPADHIAPEMAKIEAEVAEQAK
AKGVKLSENAVDDALIVALFPQIAWKFLENRNNPAAFEPAPTSNESAVENKPVSKAAPAA
SGSAVYTVELEGKAFVVKVSEGGDISHMATTTPQAAPQAAPAPAPTSGGTPVTAPMAGNI
WKVVATEGQTVVAGDVLFILEAMKMETEIKAAKGGTVRGIVVKAGDAVAVGDTVMTLV
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaattaaagtgaccgaactggtgcttcgtgatgcccaccaatcgcttttt
gcaacccgtttgcgtcttgatgacatgttgccgattgcccatgaactggacgacatcggt
tattggtcgctggaagcttggggcggtgcgacatttgacagctgtattcgttttttgggt
gaagatccgtgggtgcgtttgcgtgagttgaaaaaagcctgcccgaaaaccccgctacaa
atgctgttgcgcggtcaaaatctgctgggttatcgccactatgccgatgacgtggtggag
cgttttgtggaacgctgcgtggcgaacggtatggatgtgttccgtgtgttcgatgccctt
aatgacccgcgtaatatgaaagcggcgttgcaagcggtgcgtaaattcggcggccatgcg
caagggacgttaagttacaccaccagccccgttcacaccatgcaaacctggctcgacacc
accgaacaattgcttgaaatcgggatcgacagcctcgtgattaaagatatgtcgggcatt
ttgaatccgatggcggcggcagaactagtacgcgaaatcaaaaaacgtttcgacgtggaa
ttgcatttacactgccactccaccaccggcatggcggaaatggccctgttaaaagccatt
gaagcgggtgtggacggtgtggatacagcgatttcctccatgtccgccacctacggtcac
cctgctacagaatccatcgtggcgaccttgcaaggcactgaatacgacaccggcttggat
attccacgcctggaaaaaatcgcagcgtattttcgcaatgtacgtaaaaaatatgcaaaa
tttgaaggtcagcttcgcggcgtggacagccgaattttggtggcgcaagtgccgggcggt
atgctcaccaacctggaaaaccaattaaaacaacaaaacgcctccgacaaattggatctg
gtgttggaagaaattccgcgtgtacgcaaagatttgggttacattccgttggtgactccg
acatcacaaatcgtcggtacccaatccgtaattaatgtgctcacagacgaacgctacaaa
accatcgccaaagaaaccgccggtatcttaaaaggcgaatacggcaaaacaccggcgccg
gtggatagcgcgctacaagcccgcgtattggaaggcgctgcgccgatgaccgaccgccct
gccgatcacattgcccctgaaatggcaaaaattgaagcggaagtcgccgaacaagccaaa
gcgaaaggggtgaaattgtccgaaaatgccgtagatgatgccttaatcgtcgcccttttc
ccgcaaatcgcgtggaaattcctggaaaatcgcaacaatcctgccgcctttgaaccggca
ccgacgagtaatgaaagtgcggtcgaaaataaacctgtttcgaaagccgcaccggcggca
tcaggatctgccgtttacaccgtggaattggaaggcaaagcctttgtggtgaaagtgagc
gaaggcggtgacatttctcatatggcaactaccacaccacaagcagcgccgcaagccgca
ccggcacctgcgccaaccagcggcggcacaccggtcactgcgccgatggcgggtaacatc
tggaaagtggtggcaacagaaggacaaaccgttgtcgcaggtgatgtgttattcattctt
gaagcaatgaaaatggaaaccgaaataaaggcggcgaaaggcggcacagtgcgtggcatt
gtggtgaaagccggcgacgccgtggcggtgggtgataccgtaatgaccctcgtgtaa

DBGET integrated database retrieval system