KEGG   Glutamicibacter arilaitensis Re117: AARI_11990Help
Entry
AARI_11990        CDS       T01320                                 

Gene name
pyc
Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
aai  Glutamicibacter arilaitensis Re117
Pathway
aai00020  Citrate cycle (TCA cycle)
aai00620  Pyruvate metabolism
aai01100  Metabolic pathways
aai01120  Microbial metabolism in diverse environments
aai01200  Carbon metabolism
aai01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AARI_11990 (pyc)
   00620 Pyruvate metabolism
    AARI_11990 (pyc)
Enzymes [BR:aai01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     AARI_11990 (pyc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp_3 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: CBT75408
UniProt: E1VUV6
Position
1333416..1336868
Genome map
AA seq 1150 aa AA seqDB search
MFEKILVANRGEIAIRAFRAGYELGAKTVAVYPHEDRNSIHRQKAAEAYQIGEEGHPVRA
YLDIDEIVRVAKEAGADAIYPGYGFLSENPDLARAAAAEGIKFIGPKADVLELAGNKVAA
LKAAREAGIPVLESSEPSDDVDFLIAEADRIGFPIFVKAVAGGGGRGMRRVDKREDLPEL
MGAAMREAGTAFGDPTVFLEQAVLRPRHIEVQILADEQGNIVHLHERDCSLQRRHQKVVE
IAPAPNLDESIRQALFRDAVKFAQTLGYQNAGTVEFLVDTVGERAGQHVFIEMNPRIQVE
HTVTEEVTDIDLVQAQMRIASGESLKDLGISQDTIQVRGWALQSRITTEDPANGFRPDVG
TITVYRSAGGSGVRLDGGTIYTGAEVSPHFDSMLVKLTCRGRDYATAVARARRALAEFRV
RGVATNIPFIQNVLGDPQFLAGDVATDFIDSRPDLLTGNESQDRGTKALNFLAHVTVNQP
NGERIEGIDPRKKLPTFPGDKSDEPERSPFDGPSKAAVPADGWRQKLLDLGPEGFAKALR
ESKAVGITDTTFRDAHQSLLATRVRTRDLLAAAPAYAHNVPQLFSMEVWGGATYDVSLRF
LGEDPWKRLELLRAELPNIPLQMLLRGRNTVGYTPYPTEVTDAFVKEAAAAGIDIFRIFD
ALNDVSQMAPAIKAVRETGTAVAEVALCYTGNLLDANEKLYTLDYYLNLAQQIVDAGAHI
IAIKDMAGLLRPAAAKKLVTALRERFDLPVHLHTHDTSGGQLATLMAAIEAGVDAVDVAS
AAMAGTTSQPSASALVAALEFTERDPDLSLDAVAALEPYWEAVRAMYKPFESGLPAPTGR
VYQHEIPGGQLSNLRQQAIALGLGERFEAIESMYASVNDMLGNVVKVTPSSKVVGDLALQ
LVGSGVPAADFETNPQNYDIPDSVIQFLSGELGNPPGGWPEPFRTKALQGRNVKNHIEDL
SAEDLAALQADSDTIRGTLNRLLFAGPTRDFEKSVENYGDLSVLHTRDYLYGLVPGFEHV
ISLGTGVRLLVKLVSVSEADEKGLRTVVVNLNGQSRQVKVRDESVESTVKSAPKADPKNT
GHVAAPFAGAVTVNVQVGDLVEAGQSVATIEAMKMEAGITANAGGVVSQVTLDGTSQVQG
GDLLLVIDPK
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaagatcttggtcgccaaccgcggtgagattgcaattcgcgctttccgtgcc
ggctacgagcttggtgcaaagactgttgctgtctacccgcatgaagatcgcaattccatt
caccgccagaaggccgcagaggcctaccagattggcgaagagggccacccggtccgcgcc
tacctggatatcgacgagatcgtccgcgttgccaaagaagccggcgcagacgcaatttac
ccaggctacggtttcctctcggaaaaccctgacctagcacgagcagccgcggcagaaggc
atcaagttcatcggtccaaaggcggacgtgcttgaactggccggcaacaaggtagctgca
ctgaaggccgctcgcgaagcagggattccagttctggaatcctccgagccaagcgatgac
gttgacttcttgatcgcagaagctgaccgcatcggcttcccgatcttcgtcaaggcagtt
gccggcggcggtggccgcggcatgcgccgtgtcgacaagcgcgaagacctgccagagctg
atgggcgcagcaatgcgcgaagccggcaccgcgttcggcgacccaaccgtcttcctggag
caggcagtactgcgcccgcgtcacatcgaggtgcagatcctcgccgacgagcagggcaac
atcgttcacctgcacgagcgcgactgctcgctgcagcgtcgccaccagaaggtcgtggaa
atcgctccggcgccgaacctcgatgagtcgatccgccaggcgctgttccgcgacgccgtg
aagttcgcacagaccctgggctaccagaacgccggcaccgtggagttcctcgtggacacc
gtgggcgagcgcgccggccagcacgtgttcatcgaaatgaacccgcgcatccaggttgag
cacaccgtaaccgaggaagtcaccgacatcgatctggtgcaggcgcagatgcgcattgcc
tccggcgagtcgctgaaggacctgggcatcagccaggacaccatccaggtacgaggctgg
gccttgcagtcccgcatcaccaccgaggatccagccaacggcttccgcccggatgttgga
accattaccgtataccgttcggctggcggctcgggcgtacgcctggatggcggcacaatc
tacaccggcgccgaggtttccccgcacttcgactcgatgctggtcaagctcacctgccgc
ggccgcgactacgcaaccgctgtagcccgtgctcgccgtgcgctggccgagttccgcgtg
cgtggcgtagctaccaacatcccattcatccagaacgtactgggcgacccgcagttcctg
gccggtgacgtcgctaccgacttcatcgattcccgcccggatctgctcaccggcaacgag
tcccaggaccgcggcaccaaggcgctgaacttcctggcccacgtgaccgtgaaccagcca
aatggcgagcgtatcgagggcatcgacccgcgcaagaagcttcctaccttcccgggcgac
aagtccgacgagccagagcgctcgccattcgatggcccatccaaggccgcagtcccagcc
gatggctggcgccagaagcttctggacctaggtccagaaggtttcgccaaggccctgcgc
gagtcgaaagctgtgggcatcaccgacaccaccttccgcgatgcgcaccagtcgctgctg
gcaacccgtgtgcgtacccgcgacctgctcgcggccgcaccagcctacgcgcacaacgtg
ccgcagctgttctccatggaagtctggggcggagcaacctacgacgtatccctgcgattc
ctgggcgaagatccatggaagcgcctggaactgctgcgcgccgaactgcctaatatcccg
ctgcagatgctgctgcgcggacgcaacaccgtgggctacaccccgtacccaaccgaggtt
accgacgctttcgtgaaggaagcagcggcagcgggcatcgacatcttccgcatcttcgac
gcgctcaacgatgtctcgcagatggctccggccatcaaggccgtacgcgaaaccggcacc
gcggtagctgaagtggccctgtgctacaccggcaacctgctggatgccaacgagaagctg
tacacgctggactactacctgaacctggcccagcagatcgtcgacgccggcgcccacatc
atcgcgatcaaggacatggcaggcctgctgcgtccggccgccgcgaagaagctggtcacc
gcgctgcgcgagcgcttcgacctgccggtccacctgcacacccacgacacctccggcgga
cagctggctaccttgatggcagccatcgaagccggtgtggacgcggtagacgtggccagc
gcggccatggcaggcaccacctcgcagccttcggcttccgctctggttgcggcgctggag
ttcaccgaacgcgatccagacctgtcgctggatgcagtggctgcgctggaaccgtactgg
gaagcagtacgcgccatgtacaagccattcgaatccggactgccagccccaaccggtcgc
gtctaccagcacgaaattccaggcggccagctctcgaacctgcgccagcaggccattgcg
ctgggtctgggcgagcgtttcgaagccatcgagtcgatgtacgcttcggtcaacgacatg
ctcggcaacgtggtgaaggtgaccccatcttccaaggtggtcggcgatctggccctgcag
ctggtcggctccggagttccggcagctgacttcgaaacgaacccgcagaactacgacatc
ccggactcggtcatccagttcctctccggagaactgggcaaccctccaggcggatggcca
gaaccgttccgcaccaaggcactgcagggacgcaacgtcaagaaccacatcgaggacctc
tcggcagaggacctggcggcattgcaggctgactcggataccatccgcggcaccctgaac
cgcctgctcttcgccggtccaacccgtgacttcgagaagtcggtggagaactacggcgac
ctgtcggtactccacacccgcgactacctctacggtttggttccaggcttcgagcacgtc
atctcgctgggcaccggtgtccgcttgctggtcaagctggtctcggtttcggaagctgac
gaaaagggcctgcgcaccgtcgtggtcaacctcaatggccagtcccgtcaggtcaaggtc
cgcgacgaatcggtggaatccaccgtgaagtccgcacctaaggctgatccgaagaacacc
ggccacgtggctgcgccattcgctggtgcggtgaccgtgaacgtacaggtcggcgatttg
gtggaggcaggacagtcggttgccaccatcgaagcgatgaagatggaagctggaattacc
gctaacgccggcggcgtagtcagccaggtaaccctggatggcaccagccaggtacagggc
ggcgatctgcttctggttattgacccgaagtag

DBGET integrated database retrieval system