KEGG   Glutamicibacter arilaitensis Re117: AARI_31390Help
Entry
AARI_31390        CDS       T01320                                 

Gene name
bdh
Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
aai  Glutamicibacter arilaitensis Re117
Pathway
aai00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:aai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AARI_31390 (bdh)
Enzymes [BR:aai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AARI_31390 (bdh)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AARI_31390 (bdh)
    1.1.1.-  
     AARI_31390 (bdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 adh_short 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CBT77338
UniProt: E1W0D5
Position
complement(3508892..3509953)
Genome map
AA seq 353 aa AA seqDB search
MRAARYYDQKDIRIEDIDEPQLKPGTVAIDVAWCGICGTDLHEYLEGPIFIPPAGHPHPI
SGESAPVTMGHEFSGTITALGEGVTGLEVGENVVVEPYIIHEDVDTGEGQQYQLSRDMNF
IGLGGRGGGLSEKIVVERRWVHPIGKIPLDEAALIEPLSVAHHAFVRSGAQAGQVAIVGG
AGPIGLLTAAVLKAKGLTVYISELSEARKAKARETGVADEVFDPRDGDVADKVREATGGR
GADAGFECSSVPAVLDMLLDAVAPGGVIVNVSIWGHKPEVDMPKLVLKEIDLRGTIGYAN
DHPDTIALVQSGKLDLAPFITGRIGLDALVSEGFDQLINNNEEHVKIIVDPRA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagcacggtattacgaccagaaggacatccggatcgaggacatcgatgagccg
cagctgaaaccgggaacagtggccatcgacgtggcctggtgcggcatttgcggcaccgat
ctgcacgaatacttggagggcccgatcttcatcccgccggcagggcatccgcacccgatt
tccggggagagcgcgccggtgaccatgggccatgaattctccggaaccattaccgccctg
ggcgagggcgtcactggcctcgaagtcggcgagaacgtcgtggtggaaccctacatcatc
cacgaggatgtggacaccggcgaaggccagcagtaccagctctcccgggacatgaacttc
atcggcctgggcggccgcggcggagggctatccgagaaaatcgtcgtggaacgccgctgg
gtgcatcccatcggcaagatcccactggatgaagccgcgctgatcgagccgctgtccgta
gcccaccacgccttcgtccgctccggtgctcaggccgggcaggtagccatcgtgggcggg
gccggcccgatcggcctgctgaccgcagcggtgctcaaagccaaggggctgacggtctac
atctcggaactctccgaggcccgcaaggctaaggcacgggaaaccggggttgccgacgag
gtcttcgacccgagggacggggacgtggcggacaaggtgcgcgaggcgaccggcggccgt
ggtgcggatgccggattcgagtgctcctcggtcccggcggtgctggacatgctcctggac
gcggtggctcccggcggggtgatcgtcaacgtctcgatctgggggcataagcctgaagtg
gacatgcccaagctggtgctaaaggaaatcgacctgcgcggcaccattggctacgccaat
gaccatccggacaccattgcattggtgcaaagcggcaagttggatctcgcgccgttcatc
accgggcgcatcggacttgatgcactggtgtccgaaggctttgaccagctgatcaacaac
aacgaggaacacgtgaagatcatcgttgatccgcgggcgtag

DBGET integrated database retrieval system