KEGG   Aeromonas hydrophila MX16A: BOQ57_01465Help
Entry
BOQ57_01465       CDS       T04629                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
aaj  Aeromonas hydrophila MX16A
Pathway
aaj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BOQ57_01465
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aaj03011]
    BOQ57_01465
Ribosome [BR:aaj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BOQ57_01465
  Bacteria
    BOQ57_01465
  Archaea
    BOQ57_01465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Spatacsin_C
Motif
Other DBs
NCBI-ProteinID: APJ13640
UniProt: A0A081UY23
Position
302003..302347
Genome map
AA seq 114 aa AA seqDB search
MEAIAKHRYARTSAQKARLVADQVRGLSVDKALNILTFSPKKAAALVKKVLESAIANAEH
NEGADIDALRVATIMVDEGPSMKRIRPRAKGRADRILKRTAHITVVVSDAKAGR
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggaagctatcgctaaacaccgttatgcccgtacttctgcccagaaagctcgtctggta
gccgatcaagtacgtggtctgtccgtagacaaggctctgaacatcctgaccttcagcccg
aaaaaggctgcagctctggtgaagaaagtgctggaatctgccattgcaaacgctgagcac
aacgaaggcgccgatatcgacgcgctgcgtgttgctactatcatggtcgacgaaggtccc
tccatgaagcgcatccgtccgcgtgccaaaggtcgtgcggatcgtatcctcaagcgtacc
gctcacatcaccgtagtggtatccgacgctaaggctgggagataa

DBGET integrated database retrieval system