KEGG   Aeromonas hydrophila MX16A: BOQ57_02820Help
Entry
BOQ57_02820       CDS       T04629                                 

Definition
(GenBank) HAD family hydrolase
  KO
K20881  5'-nucleotidase [EC:3.1.3.5]
Organism
aaj  Aeromonas hydrophila MX16A
Pathway
aaj00230  Purine metabolism
aaj00240  Pyrimidine metabolism
aaj00760  Nicotinate and nicotinamide metabolism
aaj01100  Metabolic pathways
aaj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BOQ57_02820
   00240 Pyrimidine metabolism
    BOQ57_02820
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BOQ57_02820
Enzymes [BR:aaj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     BOQ57_02820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 HAD NIF Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: APJ13893
Position
complement(581087..581755)
Genome map
AA seq 222 aa AA seqDB search
MPTLLPWHQIDTVLLDMDGTLIDLHFDNHLWQQLVPERYAERLGLPLAEARVQIEAHYQA
VSGTLNWYCVDYWSETLGLDIRALKQEILAKIQWRPHVIPFLAALRAAGKQLVLFTNAHP
ASLSVKDAQLGLAGHLDLMVSTHELGWSKESQHCWQALAERLAFDPARTLFVDDSERILR
AAADYGIGYQLAIQNPDSCQPEQHITAFPAIRDYAELLPLAV
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccctactgccctggcaccagatagacactgtcctgctcgatatggatggcacc
ctgatcgatctccattttgacaaccacctctggcagcagctggtacccgagcgctatgcc
gagcgactcggcctgccgctggccgaggccagagtgcagatcgaggcgcactaccaggcc
gtcagcggcaccctcaactggtactgcgtggattactggagcgaaacgctggggctcgac
atccgtgccctcaagcaggagatcctggccaagatccagtggcggccccacgtcatcccc
ttcctggccgcgctgcgggccgcgggcaagcagctggtgctcttcaccaatgcccacccc
gccagcctgtcggtgaaggatgcgcagctggggctggccggccacctcgatctgatggtg
agcacccacgagctgggctggtcgaaggagagccaacactgctggcaggcactggccgag
cggctggcgttcgacccggcccgcactctctttgtagatgacagcgagcggatcctgcgc
gccgccgccgattacggcatcggctatcagctcgccatccagaacccggacagttgccag
cccgagcagcacatcaccgccttcccggcgatccgcgactacgccgagttattgccgctg
gccgtgtaa

DBGET integrated database retrieval system