KEGG   Aeromonas hydrophila MX16A: BOQ57_11750
Entry
BOQ57_11750       CDS       T04629                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
aaj  Aeromonas hydrophila MX16A
Pathway
aaj00230  Purine metabolism
aaj01100  Metabolic pathways
aaj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BOQ57_11750
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: APJ15552
UniProt: A0A3T0ZXF3
Position
complement(2507185..2507670)
AA seq 161 aa
MMQPQSCPTVAIQCEINGKPYSYAVSPTMSLLHFLRGQGLISVKEGCSVGECGACTVRVD
GTAIDSCLYLAVWADGKSIRTVEGERQGNELSDVQQAFIDEGAVQCGFCTPGLVMASAAL
LDKTERRPLSEAEIRRGLSGNLCRCTGYQNVVRAVKKCCKG
NT seq 486 nt   +upstreamnt  +downstreamnt
atgatgcaaccgcaaagctgtcccactgttgcgatccagtgcgagatcaacggcaaaccc
tactcctacgcggtgtcgcccaccatgtcgctgcttcacttcctgcgcggacaggggctt
atcagcgtgaaagagggatgcagtgtcggtgagtgcggcgcctgtaccgtgcgggtggat
ggcacggccatcgacagctgcctctatctggcggtgtgggccgatggcaaatccattcgt
accgttgagggggagcggcagggcaacgagctctccgacgtgcaacaggcctttatcgac
gagggggcggtgcagtgcggcttttgcaccccgggcctcgtgatggcgagcgccgccctg
ctcgacaagacagagcgccgtcccttgagcgaggcggagatccgccgcggcctgtcgggg
aatctgtgccgctgcaccggttatcagaacgtggtgcgggcggtgaagaagtgctgcaag
gggtga

DBGET integrated database retrieval system