KEGG   Aeromonas hydrophila MX16A: BOQ57_11760
Entry
BOQ57_11760       CDS       T04629                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
aaj  Aeromonas hydrophila MX16A
Pathway
aaj00230  Purine metabolism
aaj01100  Metabolic pathways
aaj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BOQ57_11760
Enzymes [BR:aaj01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     BOQ57_11760
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: APJ15554
Position
complement(2508538..2510856)
AA seq 772 aa
MSIGLPLKRVDAEAKVTGSARYTDDNIMLGMRHAKYVRSSIAHGKVLTIDASEALALHGV
EAVFTHEDVPTTCFRTAGHAWSLDETKRDVKDRRLLTDHVRHFGDGVAIVVARDPLVAEK
AAALVKVTYEPLPVMTDAASALAEGACPIHPTGNLLRQSQIRAGEPEQAIAAADLQFKGH
YQTPVVQHCHLETVTCYAYMDQPDHIIVVTSTQIPQIVRSRVAKSLGLPWSSVRVIKPYM
GGGFGNKQDVLEEPMAAFLSYQLGGVPVKVTLSREECFFASRTRHGFAIDGTLGINRDGT
LKGYQLDVLSNTGGYASHGHSIASAGANKISYLYPRSAFGYDAKTFYSNLPTAGAMRGYG
APQVVFALECMLDDACAELGLDPLAVRIANVAREGDVNQVNQKTIYSAGLPECLRRGGEQ
FEWERLKAECLAQDPTSRVRRGIGVACFSYGSNTYPVGVEIAGARMLLNQDGTVNLQIGA
TEIGQGSDTVFAQMAAQTLGIPFEQIRVISTQDTDITAYDPGSFASRQSYVAAPAIHQAA
LQLRARILSLAAQLCHQDVGSLTLIDGYVVLAGAPDKVLISVAEVSVNAYYHLTIGGQIT
SEVSHKTTTNPPSFGCTFVDLSVDIDLCKVTINRILNLHDAGKILNPQLAEGQVHGGMGM
GIGWSLFEEMIIDAKTGVVRNPNLLDYKFPTMLDLPELECDFVQTYEPQSVYGHKSLGEP
PIISPGPAIRNAIRMATGVAINELPITPKTLFREFVAAGLIGEGAGEEQHHV
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtccataggattaccgctcaagcgggtggatgccgaggccaaggtgaccggcagcgcc
cgctacaccgacgacaacatcatgcttggcatgcgccacgccaaatacgtgcgaagctcc
atcgcccacggcaaggtgctcaccatcgatgccagcgaagcgctggccctgcacggggtc
gaagccgtgttcacccatgaagatgtgcccaccacctgctttcgcaccgccggtcacgcc
tggtcccttgatgagaccaaacgggacgtgaaagaccgccgtctgctcaccgaccatgtg
cgtcacttcggcgatggggtcgccatcgtggtggcgcgcgatcccctggttgccgagaag
gccgccgccctggtcaaggtgacctacgagccgctgccggtgatgacggatgcggccagc
gccctggccgagggggcctgtcccatccacccaaccggcaacctgctgcgccagagccag
atccgggcgggagagccggagcaggccatcgccgcggccgatttgcagttcaaggggcac
taccagacgccggtggtgcagcactgccatctggagacggtgacctgctacgcctacatg
gatcagccggaccacatcatcgtggtcaccagcacccagatcccccagattgtgcgcagc
cgggtggccaaatccctcggcctgccctggtccagcgtgagggtgatcaagccctacatg
ggcggcggttttggcaacaagcaggatgtgctggaagagccgatggcggcgtttctgagt
taccagctcggcggcgtgccggtcaaggtgaccctgagccgggaggagtgcttctttgcc
tcccgcacccgccacggctttgccatcgatggcaccctcggcatcaaccgggatggcacc
ctcaagggctatcagctggacgtgctctccaacaccggcggctatgcctcccacggccac
tccatcgccagtgccggcgccaacaagataagctacctctatccgcgcagcgccttcggt
tatgacgccaaaaccttctacagcaacctgcccaccgccggtgccatgcgcggctacggc
gcgccgcaggtggtgtttgccctcgaatgcatgctggacgatgcctgcgccgagctggga
ctcgacccgcttgcggtgcgcatcgccaacgtggcccgcgaaggggacgtcaatcaggtc
aaccagaaaaccatctacagcgcagggctccctgagtgtctgcgccggggcggcgagcag
tttgagtgggagcggctcaaggccgagtgtctggcacaggatcctacgagccgggtacga
cgcggcatcggggtggcctgctttagctacggctccaacacctatccggtaggggtggag
atcgccggcgcccgcatgctgctcaaccaggatggcaccgtcaatctgcagataggtgcc
accgagatagggcagggctcggataccgtctttgcccagatggcggcccagaccttgggc
attccgtttgagcagatccgggtcatctcgacccaggataccgacatcaccgcctatgat
ccgggttcgttcgcctcgcgccagagctatgtggcggcccccgccatccatcaggcggcg
ctgcagttgcgggcccgcatcctgtcgctggcggctcagctctgccatcaggatgtggga
tcgctgaccctgatcgatggctatgtagtgttggccggcgcgccggacaaggtgctcatc
agcgtcgccgaggtgtcggtcaacgcctattaccacctcaccatcggcggccagatcacc
tcggaggtctcccacaagaccaccaccaacccgcccagttttggctgcaccttcgtcgat
ctcagcgtcgacatcgatctctgcaaggtgaccatcaaccgcatcctcaacctgcacgat
gcgggcaagatcctcaacccgcagctggcggaggggcaggtgcacggcggcatggggatg
gggatcggctggtcgctgttcgaggagatgatcattgacgccaagaccggcgtggtgcgc
aaccccaacctgcttgactacaagttccccaccatgctggatttgcccgaacttgagtgc
gacttcgtgcagacctacgagccccagtcggtctatggtcacaaatccctgggggaaccg
cccatcatctcgccgggcccggcgatccgtaatgccattcgcatggcgaccggggtcgcc
atcaacgagctgcccatcacccccaagaccctgtttcgggagtttgtcgcggcgggtctg
attggcgagggagcaggggaggagcaacaccatgtttga

DBGET integrated database retrieval system