KEGG   Aeromonas aquatica: BOQ57_11930Help
Entry
BOQ57_11930       CDS       T04629                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aaj  Aeromonas aquatica
Pathway
aaj00071  Fatty acid degradation
aaj00072  Synthesis and degradation of ketone bodies
aaj00280  Valine, leucine and isoleucine degradation
aaj00310  Lysine degradation
aaj00362  Benzoate degradation
aaj00380  Tryptophan metabolism
aaj00620  Pyruvate metabolism
aaj00630  Glyoxylate and dicarboxylate metabolism
aaj00640  Propanoate metabolism
aaj00650  Butanoate metabolism
aaj00900  Terpenoid backbone biosynthesis
aaj01100  Metabolic pathways
aaj01110  Biosynthesis of secondary metabolites
aaj01120  Microbial metabolism in diverse environments
aaj01130  Biosynthesis of antibiotics
aaj01200  Carbon metabolism
aaj01212  Fatty acid metabolism
aaj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BOQ57_11930
   00630 Glyoxylate and dicarboxylate metabolism
    BOQ57_11930
   00640 Propanoate metabolism
    BOQ57_11930
   00650 Butanoate metabolism
    BOQ57_11930
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BOQ57_11930
   00072 Synthesis and degradation of ketone bodies
    BOQ57_11930
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BOQ57_11930
   00310 Lysine degradation
    BOQ57_11930
   00380 Tryptophan metabolism
    BOQ57_11930
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BOQ57_11930
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BOQ57_11930
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BOQ57_11930
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aaj04147]
    BOQ57_11930
Enzymes [BR:aaj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BOQ57_11930
Exosome [BR:aaj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BOQ57_11930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APJ15587
Position
complement(2555802..2556965)
Genome map
AA seq 387 aa AA seqDB search
MDIVIVAAKRTPMGAFQGALANLTAPELGACAIAAAMAEVGLRGEQIDEAYLGNVLSAGV
GQAPARQAVLKAGLPDSIPCTTVNKVCGSGMKAVMLAADGLRLGDTNVVIAGGMESMSRA
PYLLDKARSGFRMGHQSVLDHMFLDGLQDAYEGQLMGHYAQLSADRAGLTRADMDAFAIA
SLERALAAQRSGAFAAELAPVMAGDTLLLAEDELPAKARPEKIPQLKPAFSKTGTITAAN
ASSISDGAAALILMRSDTAAQLGLPVLARLVGYQSHAALPAEFTSAPIGAIKGLLAKVGW
RVEEVDLFEVNEAFAMVSLLAMAGCQLPHDKVNVNGGACALGHPLGASGARILVTLIHAL
RERGLTRGVASLCIGGGEATAVAIELG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtgattgttgcggccaaacgtacccccatgggggccttccagggagccctg
gccaacctgacggctcccgagctaggcgcctgtgccattgctgcggccatggcagaggtc
gggctcaggggggagcagatcgatgaagcctatctgggcaacgtgctgagtgccggggtc
ggccaggcacccgcccgtcaggcggtgctgaaggcgggcctgccggacagcatcccctgc
accacggtcaacaaggtgtgcggttccggtatgaaggcggtgatgctggcggccgatggc
ttgcgactcggcgatacgaacgtggtgatcgccggcgggatggagagcatgagccgcgcc
ccctatctgctggacaaggcgcgcagcggttttcggatggggcaccagagcgtgctcgat
cacatgtttctcgacgggctgcaggatgcctacgaagggcagctgatggggcattatgcc
cagctgagcgccgatcgcgccgggttgacccgtgccgacatggatgcttttgccatcgca
tcgctggagcgggcgctggcggcccagcgcagcggtgcctttgcggcggaactggcgcca
gtgatggccggagataccctgctgctggccgaggatgagctgcctgccaaggccagaccc
gagaagatcccccagctcaagccggctttcagcaagacgggcaccatcacggcagccaat
gccagctccatctcggacggggcagcggcgctgatcttgatgcgttccgacactgctgcg
cagctggggctgccggtgctggcgcgactggtgggttatcagagccacgcggccctgccc
gccgagtttaccagcgcaccgatcggggccatcaaggggctgctggccaaggtgggttgg
cgggtggaggaggtggacttgttcgaggtcaacgaggcgtttgccatggtcagcctgctg
gcgatggctggttgccagctgccccatgacaaggtcaatgtgaacggcggcgcctgcgcg
ctcggtcatccgctgggggcgagtggcgccaggatcttggtgaccctgatccatgctctg
cgcgaacgcggtctcacacgcggggtggccagtctgtgtatcgggggcggggaggcgacg
gcggtcgccatcgagctgggttaa

DBGET integrated database retrieval system