KEGG   Aeromonas hydrophila MX16A: BOQ57_20885Help
Entry
BOQ57_20885       CDS       T04629                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
aaj  Aeromonas hydrophila MX16A
Pathway
aaj00561  Glycerolipid metabolism
aaj00640  Propanoate metabolism
aaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BOQ57_20885 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BOQ57_20885 (gldA)
Enzymes [BR:aaj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     BOQ57_20885 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: APJ17175
Position
complement(4476892..4477974)
Genome map
AA seq 360 aa AA seqDB search
MDRIIISPSKYVQGNGALANIGNYVKALGAKPLILADAFVTKLVGDTVATSFHGAGIQPE
FDCFNGECSRPEIDRLLARCKQTPFDVIIGIGGGKTLDTAKSVAFYQQVPVVIVPTIAST
DAPTSALAVIYTPEGQFSEYLMIPTNPNMVIMDTGVVARAPVRLLVSGMGDALSTYFEAR
ANKVSGCKTMAGGASTLAAQAIAKLCYKTLLADGYKAKLAVEQGLCTKAVENIIEANTYL
SGIGFESSGLAAAHAVHNGLTQLAECHHLYHGEKVAFGTLVQLVLENAPMAEIETVLGFC
RSIGLPTNLHMMGVKELDMARLMDVAKASTAEGETIHNMPFKVTAEDVLAAIVTAHQLGL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcatcatcatcagccccagcaaatacgtgcaaggcaacggggccctcgccaat
atcggcaactacgtcaaggcgctcggcgccaagccgctgatcttggccgacgccttcgtc
accaagctggttggcgataccgtggccaccagcttccacggggcaggcatccagcccgag
ttcgactgcttcaacggcgagtgctcccgccccgaaatagatcgcctgctggcgcgctgc
aagcagaccccgtttgacgtcatcatcggcatcggcggcggcaagacgctggataccgcc
aagtcggtcgccttctaccagcaggtgccggtggtcatagtgccgaccatcgcttccacc
gatgcccccaccagcgcgctggcggtcatctacaccccggaagggcaattcagcgaatac
ctgatgatcccgaccaaccccaacatggtcatcatggataccggtgtggtcgcccgtgcc
ccggtgcggctgctggtctccggcatgggggatgcgctctccacctacttcgaggcgcgc
gccaacaaggtgtccggttgcaagaccatggccggtggtgcctccaccctggcggcgcag
gccatcgcgaagctctgctacaagaccctactggccgatggctacaaggccaagctggcg
gtggagcaggggctttgcaccaaggcggtggagaacatcatcgaggccaacacctatctg
agcggtatcggtttcgagagcagcggtctggccgccgcccacgccgttcacaacggcctg
acccagctggccgagtgtcaccacctctatcacggtgagaaagtggcgttcggcaccctg
gtgcagctggtgctggagaatgcgccgatggcggagatcgaaaccgtattgggtttctgc
cgctcgattggcctgcccaccaacctgcatatgatgggggtcaaggagctggacatggcg
cgcctgatggacgtggccaaggcctccactgcggagggggagaccatccacaacatgccg
ttcaaggttaccgccgaggacgtgctggcggccatcgtcaccgcccaccagctggggctg
taa

DBGET integrated database retrieval system