KEGG   Aeromonas hydrophila MX16A: BOQ57_21270Help
Entry
BOQ57_21270       CDS       T04629                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
aaj  Aeromonas hydrophila MX16A
Pathway
aaj00564  Glycerophospholipid metabolism
aaj01100  Metabolic pathways
aaj01110  Biosynthesis of secondary metabolites
Module
aaj_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BOQ57_21270
Enzymes [BR:aaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     BOQ57_21270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PSDC PS_Dcarbxylase RnfC_N
Motif
Other DBs
NCBI-ProteinID: APJ17244
Position
complement(4558450..4559820)
Genome map
AA seq 456 aa AA seqDB search
MNKAVETRLNKSRPGGWIPRDGAHIERWIRRIKHYVTQQPRALVPPIAELRDLVHADPAL
HTQAEAMFKEAWRHKHLTPLGQPEVRSFEEFLGLLNGIMTTAPEAYQDIPSHEPSGLIGF
PINALLDWPMATQSGYHFFANALINQQFKKILDYWAQFLQSPASRYVLNEPVSRLDQETL
VVPWLGKVAKAEMVKVANEAVGEGPNPTPGSFEQIFECEPAAEYHGFSCWDDFFTRRFRA
GVRPVSAPTDDSVIVNACESAPLQVRKEVSRSDQFWLKGQPYSLDNMLDFDDLAPRFEGG
TVYQAFLSALSYHRWHSPVSGTIRKVRIVNGTYYLENQFEGFADPQGADPSAPNNSQPFL
TSVATRALIFIEADNPKIGLMCVVPVGMAEVSSCEITVQAGDRVQKGDPLGMFHFGGSTH
CLLFRPGVRLEFDFHGQTPGLDATNMRLNTAIARVK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggcagtggaaacccgattgaacaagtcccgtcccggtggctggatcccccgt
gatggcgcccatatcgagcgctggatccggcggatcaagcactacgtgacccagcagccg
cgggcgctggtgccacccatcgccgagctgcgggatctggtccatgccgaccctgcgctg
catacccaggccgaagccatgttcaaggaagcctggcgccacaagcacctgaccccgctc
ggtcagccggaggtacgctcgttcgaggagttcctggggctgctcaacggcatcatgacc
acggcgcccgaggcgtatcaggacatccccagccacgagccatccggtctcatcggcttt
cccatcaatgccctgctcgactggcccatggccacccagtccggctatcacttctttgcc
aacgccctgatcaaccagcagttcaagaagatcctcgactactgggcccagttcctgcaa
agcccggcgtcccgctatgtgttgaatgaaccggtcagccggctggatcaggagaccctg
gtggtgccctggctcggcaaggtggccaaggccgagatggtcaaggtggcgaacgaggcg
gtcggggaggggcccaaccccacgccgggcagcttcgagcagatcttcgagtgcgagccg
gcggccgagtaccacgggttcagctgctgggacgacttcttcacccgccgttttcgggcc
ggggtgcggccggtatctgcgccgacggatgacagtgtcatcgtcaacgcctgcgagtcg
gcgccgctgcaggtgcgcaaggaggtgagccgcagcgatcagttctggctcaaggggcag
ccctattcgctggacaacatgctcgattttgacgatctggcgccccgtttcgagggtggc
accgtctaccaggccttcctcagtgcgctcagctaccaccgctggcacagcccggtgagc
ggcaccatccgcaaggtgcgcatcgtcaacggcacctactatctggaaaaccagttcgaa
ggctttgccgacccgcagggggcggatcccagcgcccccaacaattcccagccgttcctc
acctcggtggcgacccgggcactcatcttcatcgaggccgacaaccccaaaatcggcctg
atgtgcgtggtgccggtggggatggccgaggtgtcgagctgcgagatcacggtgcaggcg
ggggatcgggtgcagaagggggatccgctcggcatgttccacttcggcggctccacccac
tgcctgttgttccgccccggcgtcaggctggagttcgacttccatggccagaccccaggg
ctggatgcgaccaatatgcggctcaataccgccatcgcccgggtcaagtag

DBGET integrated database retrieval system