KEGG   Aminobacter aminovorans: AA2016_0180Help
Entry
AA2016_0180       CDS       T04343                                 

Definition
(GenBank) 3-dehydroshikimate dehydratase
  KO
K15652  3-dehydroshikimate dehydratase [EC:4.2.1.118]
Organism
aak  Aminobacter aminovorans
Pathway
aak00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aak01100  Metabolic pathways
aak01110  Biosynthesis of secondary metabolites
aak01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AA2016_0180
Enzymes [BR:aak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.118  3-dehydroshikimate dehydratase
     AA2016_0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AMS39122
UniProt: A0A142LYF2
Position
178865..179710
Genome map
AA seq 281 aa AA seqDB search
MKISLCTITFRHHLVSLEDIARWAGANDFQGIELWGAHARNLAYQPQCDADWLAGQGLYV
PMVSDYLPLDGDAETLRKKTVDLCRLARHWRAGKIRTFAGSRGSRDTPAEVRRILTARLH
EVAGMAADFDLELLAETHPGTLADCGASTLRLVAEVDHPAFKINFDTLHVWEGGDDPVAA
HSAMRPHIRHYHLKNVRSRADLRVFEPANVYAAAGSREGMTPLFDGKVDYRRFLAELRDD
PTVEASLEWFGNDCFNVLRSDRQAIKRLKSPNEVLLRTGSF
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctcgctctgcaccatcaccttccgccatcatctcgtctcgctcgaggacatc
gccagatgggctggggccaacgacttccagggcatcgagctgtggggcgcgcatgcgcgt
aacctggcctaccagccgcaatgcgacgccgactggctggccgggcaagggctctatgtg
ccgatggtcagcgactacctgccgctcgacggcgacgccgaaaccttgcgcaagaagacc
gtcgacctgtgccgcctcgcccggcattggcgggcgggcaagatccgcacctttgccggc
agccgcggcagccgggataccccggccgaggtcaggcgtatcctcaccgcgcggctgcac
gaggttgccgggatggccgcggatttcgacctagaacttttggccgaaacgcatcccggc
acgctggccgattgcggcgcctcgacgctcaggctggtcgccgaggtcgaccatccggcg
ttcaagatcaattttgacacgctgcatgtctgggaaggcggcgatgaccccgtcgccgcg
cattcagcgatgcgtccccatatccgccattaccatctcaagaatgtgcgctcgcgcgcc
gatctcagggtcttcgagccggctaatgtctatgctgcagccggcagccgcgaaggcatg
acgccgctgttcgacggcaaggtcgactatcggcgcttccttgcagagctgcgcgacgac
cccactgtcgaggcctcgctcgaatggttcggcaatgattgcttcaatgtcctgcgcagt
gaccgacaagcaatcaagcgtctgaaaagccccaacgaagtcttgctgcgcaccggcagc
ttctga

DBGET integrated database retrieval system