KEGG   Aminobacter aminovorans: AA2016_3846Help
Entry
AA2016_3846       CDS       T04343                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
aak  Aminobacter aminovorans
Pathway
aak00970  Aminoacyl-tRNA biosynthesis
aak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aak00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AA2016_3846
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aak03029]
    AA2016_3846
Enzymes [BR:aak01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AA2016_3846
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AA2016_3846
Mitochondrial biogenesis [BR:aak03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AA2016_3846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AMS42765
UniProt: A0A142M8U5
Position
complement(3931469..3933034)
Genome map
AA seq 521 aa AA seqDB search
MTDLTRLTIAEAREKLRGKEITATELTDAYVKAIDQANATFNAYVATTPDKAREMAKASD
ARLARGDGGALEGIPLGIKDLFATEGVHTQACSHVLDGFEPRYESTVTANLWADGAVMLG
KLNMDEFAMGSSNETSYYGPVINPWRRSRTETVVMPTTHQGDGGFVASGGAKTARSYDNM
QLVPGGSSGGSAAAVSAFLCAGATATDTGGSIRQPAAFTGTVGIKPTYGRVSRWGTVAFA
SSLDQAGPIARDVRDAAILLKSMASVDAKDTTSVDLPVPDYEAAIGKSVKGMKIGIPKEY
RVDGMPEDIEALWQKGIAWLRDAGAEIVDISLPHTKYALPAYYIVAPAEASSNLARYDGV
RYGLRVPGKDIIEMYENTRAAGFGREVKRRIMIGTYVLSAGYYDAYYLQAQKVRTLIKRD
FELAFAAGVDVILTPATPSAAFGVADEDMAADPVKMYLNDIFTVTVNMAGLPGIAVPAGL
DGHGLPLGLQLIGRPFDEETLFQTAHVIEQAAGRFQPDKWW
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctgaccagactgacgattgccgaagcgcgcgagaagctgcgcggcaaggag
atcaccgccacggagctgaccgacgcctacgtcaaggcgatcgatcaggccaacgcgacc
ttcaacgcctatgtcgccaccacgcctgacaaggcgcgcgagatggccaaggcgtccgac
gccaggctcgccaggggcgacggcggtgcgctcgagggcattccgctcggcatcaaggat
ctgttcgccaccgaaggcgtgcatacccaggcctgcagccatgtgctggacggtttcgag
ccgcgctacgaatcgacggtgacggccaatctgtgggccgacggtgctgtcatgctcggc
aagctcaacatggacgagttcgccatgggctcgtccaacgagacctcctattacggtcca
gtgatcaacccgtggcggcggtcgcgcaccgagacggtggtgatgccgacaacccatcaa
ggcgatggcggcttcgttgcatcaggtggcgcaaagaccgcgcgcagctatgacaacatg
caacttgtgccaggcggctcctcgggtggctctgcggcagccgtttcggccttcctctgc
gccggtgcgacggccaccgacacgggcggctcgatccgccagccggcggcctttaccggc
actgtcggcatcaagccgacctatggccgtgtgtcgcgctggggcaccgttgccttcgcc
tcgtcgctcgaccaggccggtccgatcgcccgcgacgtgcgcgacgctgcgatcctgctc
aagtcgatggcctccgtcgatgccaaggacaccacttcggtcgacctgccggtgccggac
tacgaagcggcgatcggcaaatcggtcaagggcatgaagatcggcattcccaaggaatac
cgcgtcgacggcatgcccgaggacatcgaggcactttggcagaagggcattgcctggctc
agggatgccggcgccgagatcgtcgatatctcgctgccgcataccaaatacgcgctgccg
gcctattacatcgtggcgcctgccgaagcgtcgtcgaacctcgctcgctatgacggcgtc
cgctacggcctgcgcgtgccgggcaaggacatcatagagatgtacgagaacactcgcgcc
gccggcttcggccgcgaggtcaagcgccgcatcatgatcggcacctatgtgctgtcggcc
ggctattacgacgcctactacctccaggcgcagaaggtgcgcacgctgatcaagcgcgac
ttcgaactggcgtttgccgccggcgtcgatgtcatcctgacgccggcaacgccttcggcc
gcgttcggcgtcgccgacgaggacatggccgccgatccggtcaagatgtatctcaacgac
atcttcacggtgacggtgaacatggccggcctgcctggcatcgccgtccccgccggcctc
gacggccacggcctgccgctcggcctgcaactgatcgggcgcccgtttgacgaagagacg
ctgttccagaccgctcatgtcatcgagcaggccgctggccgtttccagccggacaaatgg
tggtag

DBGET integrated database retrieval system