KEGG   Aminobacter aminovorans: AA2016_3993Help
Entry
AA2016_3993       CDS       T04343                                 

Definition
(GenBank) adenosylmethionine-8-amino-7-oxononanoate aminotransferase
  KO
K00833  adenosylmethionine---8-amino-7-oxononanoate aminotransferase [EC:2.6.1.62]
Organism
aak  Aminobacter aminovorans
Pathway
aak00780  Biotin metabolism
aak01100  Metabolic pathways
Module
aak_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:aak00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AA2016_3993
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aak01007]
    AA2016_3993
Enzymes [BR:aak01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.62  adenosylmethionine---8-amino-7-oxononanoate transaminase
     AA2016_3993
Amino acid related enzymes [BR:aak01007]
 Aminotransferase (transaminase)
  Class III
   AA2016_3993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AMS42910
UniProt: A0A142M990
Position
4081065..4082327
Genome map
AA seq 420 aa AA seqDB search
MSRSAVWHPFTQHAAEPVPPVIARTEGAYVETTEGKRILDAISSWWVITHGHRHPKIVEA
IRNATETLDQVIFAGLTHEPAEKLASALVEMAPSGLDWVFFSDSGSTSVEVALKMALGFH
RNNGSPRSRLVVMEHSYHGDTIGTMSVGERGVFNAAYDPLLFEVDTIPFPAAGREQETLD
RFEALTRDGKAAAVIVEPLVLGAGGMLIYPARVLTELKRIAEKSGTLFIADEVMTGWGRT
GTMFACEQAGISPDILCTSKGLTGGSVPLAATLATDAIFRAHFSTDRAKTFFHSSSYTAN
PIACAAALANVGIWRDEPVTERVAALSKMQAEKIARFNGDARFENVRTAGTIAAVDLLVG
KAGYLAEVGPKLRAFFLERGHLVRPLGNVIYVLPPYCVTAAELDRLYDAVDEAAELAKSG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttccgccgtctggcatcccttcacccagcacgccgccgagcccgtgccgccc
gtcatcgcgcgcaccgagggcgcctatgtcgaaacgacagagggcaagcgcatcctcgac
gcgatctcctcctggtgggtcatcacccatggccaccgccatccgaaaatcgtcgaggcg
atccgaaatgccaccgaaacactcgatcaggtcatcttcgccggcctgacccacgagcca
gcggaaaaattggcctcggcacttgtcgagatggcgccctcaggcctcgactgggtgttt
ttttccgacagcggctcgaccagcgtcgaggtcgcgctgaagatggcgctcggtttccac
cgcaacaatggttctccgcgctcgcgcctcgtcgtgatggagcacagctatcatggcgac
accatcggcacgatgagcgtcggcgaacgcggcgtgttcaacgccgcctacgacccgctg
ctgttcgaggtcgacaccatccccttccccgcagccggccgcgaacaggagacgctcgac
cgcttcgaggctttgacccgcgacggcaaggctgctgccgtcatcgtcgaacccttggtg
ctcggcgccggcggcatgctgatctatccggcccgggtgctgaccgagctcaagcgcatc
gccgaaaagtccggcacgctgttcatcgccgacgaggtgatgaccggatggggccgcacc
ggaaccatgttcgcctgcgaacaggctggcatctcgcccgacattctctgcacatcgaag
ggcctgaccggcggctcggtgccgctggcagcgacgctcgccaccgacgcgatcttccgg
gcgcatttctccaccgatcgcgccaagaccttctttcattcgagctcctacaccgcgaac
cccatcgcctgcgctgcggccctcgccaatgtcgggatctggcgcgacgagccggtgact
gagcgtgtggcggccttgtcgaagatgcaggcggagaagatcgcgcgcttcaacggcgat
gcacgttttgagaatgttcggacggccggcaccatcgccgccgtcgacctgcttgtcggc
aaggcaggttatctcgccgaagtcgggccgaagctgcgcgcattcttcctcgagcgcggc
cacctggtccgcccgctcggcaacgtcatctacgtactgccaccctattgcgtcaccgca
gccgagctcgaccggctctatgacgccgtcgacgaggccgccgagctggcgaagagcgga
tga

DBGET integrated database retrieval system