KEGG   Aminobacter aminovorans: AA2016_4785Help
Entry
AA2016_4785       CDS       T04343                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aak  Aminobacter aminovorans
Pathway
aak00071  Fatty acid degradation
aak00072  Synthesis and degradation of ketone bodies
aak00280  Valine, leucine and isoleucine degradation
aak00310  Lysine degradation
aak00362  Benzoate degradation
aak00380  Tryptophan metabolism
aak00620  Pyruvate metabolism
aak00630  Glyoxylate and dicarboxylate metabolism
aak00640  Propanoate metabolism
aak00650  Butanoate metabolism
aak00900  Terpenoid backbone biosynthesis
aak01100  Metabolic pathways
aak01110  Biosynthesis of secondary metabolites
aak01120  Microbial metabolism in diverse environments
aak01130  Biosynthesis of antibiotics
aak01200  Carbon metabolism
aak01212  Fatty acid metabolism
aak02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AA2016_4785
   00630 Glyoxylate and dicarboxylate metabolism
    AA2016_4785
   00640 Propanoate metabolism
    AA2016_4785
   00650 Butanoate metabolism
    AA2016_4785
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AA2016_4785
   00072 Synthesis and degradation of ketone bodies
    AA2016_4785
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AA2016_4785
   00310 Lysine degradation
    AA2016_4785
   00380 Tryptophan metabolism
    AA2016_4785
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AA2016_4785
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AA2016_4785
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AA2016_4785
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aak04147]
    AA2016_4785
Enzymes [BR:aak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AA2016_4785
Exosome [BR:aak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AA2016_4785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AMS43694
UniProt: A0A142MBH4
Position
4885632..4886822
Genome map
AA seq 396 aa AA seqDB search
MNSHDPVVIAGAARTPLGGFLGSLKEVTAPQLGAAAIRAVLERSGLDTGLVDQVLMGCVL
TAGQGQAPARQAALAAGLPLATGATTVNKMCGSGMMSAMLAHDLIAAGSARTIVAGGMES
MSNAPYLLDRARSGYRIGHHRLVDHMYLDGLEDAYDEGRLMGTFAEDCAEAYGFTRDAQD
TFALESLDRARQAIADGSFRDEIVPVTAPDGKADRLVGDDEQPQKARPDRIALLKPAFRD
GGTVTAANSSSISDGAAALALMRRSAADRAGLTPLATIRGHVTHAQAPNLFTSAPVGAMR
KLCETVSWRIEDVDLFEINEAFAVVPMVAMSELDLPRDKVNVHGGACALGHPIGASGARI
LVTLVSALRQHGLRRGIASVCIGGGEATAMAVELTS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagtcatgatccggtggtcatagcaggggcagccaggacaccgcttggcggcttc
ctcggaagcctgaaggaggtcaccgccccgcagcttggagcggcagccatccgcgccgtc
ctggagaggtccgggctggacaccggccttgtcgaccaggtgctgatgggctgtgtcctg
accgccggccaaggccaggcgccggcgcgccaggcagcgcttgcagccgggctgccgctc
gccacaggcgccaccaccgtcaacaagatgtgcggctccggcatgatgtcggcgatgctg
gcgcacgacctcatcgccgcgggatcggccaggacgatcgtcgccggcggcatggagagc
atgtcgaacgcaccctatctgctcgaccgcgcacgctcgggctaccgcatcgggcatcat
cgcctcgtcgaccacatgtatctcgatggcctcgaggacgcctatgacgaggggcgcctg
atgggcacattcgccgaggactgcgccgaggcctatggcttcacgcgcgatgctcaggac
acgtttgcgctggagtcgctcgacagggcacggcaggccatcgccgacggcagctttcgc
gacgagatcgttccggtcacggcaccggacggcaaggccgatcggctggtcggcgacgac
gagcagccgcaaaaggcccgccccgacaggatcgccttgctgaaaccggcctttcgcgac
ggcggcacggtgacggcagccaactcctcgtcgatctcggatggtgccgcggccctcgcg
ctgatgcgccgctcggcggcggacagagccggcctcacccctctcgcaacaattcgcggc
cacgtcacccacgcccaggcgcccaatctcttcacctcggcaccggtcggcgccatgcgc
aagctctgcgagacggtcagctggcgtatcgaggacgtcgatctcttcgagatcaacgag
gccttcgccgtggtgccgatggtcgcgatgagcgagctcgacctgccgcgcgacaaggtc
aacgtccatggcggcgcctgcgcgcttggccatccgatcggcgcctcgggggcgcgcatc
ctcgtcacgctcgtgtcggcgctgcgccagcacgggctgcggcgcggcatcgcttcggtc
tgcatcggcggcggcgaggcgaccgcgatggccgtggaactgacgtcctag

DBGET integrated database retrieval system