KEGG   Aminobacter aminovorans: AA2016_4964
Entry
AA2016_4964       CDS       T04343                                 

Definition
(GenBank) Aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL-like protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
aak  Aminobacter aminovorans
Pathway
aak00230  Purine metabolism
aak01100  Metabolic pathways
aak01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aak00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AA2016_4964
Enzymes [BR:aak01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     AA2016_4964
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C Peptidase_M24
Other DBs
NCBI-ProteinID: AMS43873
UniProt: A0A142MC03
Position
complement(5075347..5077653)
AA seq 768 aa
MNMTTPIEKRDFKIVGKSVRRDDVLEKVTGEAEYTGDVKLSGMLHGKIKRAAIAHARIKS
IDVSKALAYPGVKAVLTHENVPRVLHYGSPHPRSASCTKDQYILDDKVRFWGEGVAAVAA
ISEEIADEALDLIEVEYEPLPAVFEPEDAAQPGAPLIHDVGPGGNLVLDPVRINRGDVDA
GFAQADFVLEGVFSGGRPHPAYMEPNVCIADWDGSNKLTFWTSTQTSFMVRGILAEVLGL
PLTKVRVLVDHMGGGFGAKQDLFQHEFLCALLAKQTRRPVKMEFSRHETFVAGRSRHPCK
IWLKQGFKNDGTLVARDMKLAYDSGAYGSHGPGVTIVGTTAATSLYRCENVRLEGRCVYT
NTPINGAFRGYGVVQSYYALDIQMDEAAERLGMDPAELKLKNVVRAGDIAPSGHPILGHG
LEICLQHGIDVLDWKKLRNRDRTPDPKRPHIRTGWGIGCEMHGSSAYPGIKEQGNATVKV
NEDGTVTLLTGAAGLGTGAHTALAQIVAEELGVRFEDVGTIHGDTDVVPWDIGAFASHTT
YLVGTAAKMAAGKVRTAVLERAAMKLQVSPAEIDLSEGKVFVITDPGRCMTVAQAMGPSR
GIPAANIVANGTYEPTKSYSFAAHFAEVHVDTETGIVEVKRVIPVHDVGRVIHPIAAQGQ
IEGGIQQGIGHTLTEDYVIDKKTGRSLNAGLVDYKMPLSMDMPDIETIILEAAPDPGGPW
GAKGVGEDPIIAIGPAIANAIHDAIGVRFRHYPITPEDVLKALREKAA
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgaacatgacgacccctatcgaaaagcgcgatttcaagatcgtcggcaagagtgttcgc
cgcgacgacgtgctcgaaaaggtgacgggcgaagccgagtataccggcgacgtcaaactg
tcgggcatgctgcacggcaagatcaagcgcgcggccatcgcgcatgcccgcatcaagagc
atcgatgtcagcaaggcgctcgcctatccgggcgtgaaggcggtgctgacgcatgagaac
gtgccgcgcgtgctgcattacggctcaccgcacccgcgctcggcttcctgcaccaaggac
cagtatatactcgatgacaaggtacggttctggggcgagggcgttgccgccgtcgcggcc
atcagcgaggagattgccgacgaggctctcgacctgatcgaggtcgagtacgagcccttg
ccggccgtcttcgaaccggaggatgcggcccagccgggtgcgccgctcattcacgatgtc
ggccctggcggcaacctcgtgctcgatccggtgcgcatcaatcgcggcgatgtggacgcc
ggcttcgcccaggcggatttcgtgctcgaaggtgttttttccggtgggcggccgcatccg
gcttacatggagccgaatgtctgcatcgccgactgggacggttccaacaagcttaccttc
tggacctccacccagacttctttcatggtgcgcggcatccttgccgaagtgctcggtctg
ccgcttaccaaggtccgcgtgctcgtcgaccacatgggtggcggttttggagctaagcag
gacctgttccagcacgaattcctgtgcgcgcttcttgccaaacagacgcgccggccagtg
aagatggaattcagccgccacgagactttcgtcgccggccgctcgcgccacccctgcaag
atctggctgaaacagggtttcaagaacgacggcacgctcgtcgcgcgcgacatgaagctg
gcctacgattccggcgcctacggttcgcacggcccaggtgtcaccattgtcggcacgacg
gctgccacctcgctttatcgctgcgagaacgtgcggctggaaggacgctgcgtctacacc
aatacgccgatcaacggtgccttccgcggctatggcgtggtgcaaagctattatgcgctc
gatatccagatggacgaggcggccgaacggctaggcatggatccggcggagctgaagctg
aagaacgtcgttcgcgccggcgacatcgcaccgtcgggccacccgatccttggtcatggc
ctcgaaatctgcctccagcacggcatcgacgtgctggattggaagaagctgcgcaaccgc
gaccgcacgccggatcccaagcgaccccacattcgcactggctggggcatcggctgcgaa
atgcacggttcttccgcctatcccggcatcaaggaacagggcaacgccacggtgaaggtc
aacgaggacggtacggtgactttgctcacgggtgccgccggcctgggcaccggcgcgcac
acagcacttgcacagattgttgcggaagaactcggagtgcgcttcgaggatgttggcacg
atccatggcgatacggacgtggtaccttgggacatcggcgcgtttgccagccacacgact
tatctcgtcggcacggctgccaagatggcagccggtaaggtccgcactgcggttctcgaa
cgggcagcgatgaagctgcaggtctcgccggccgagatcgatctttccgaaggcaaggtc
ttcgtcatcaccgatccaggacgctgcatgacggtcgctcaggcgatgggtccttcccgt
ggcattcccgccgccaacatcgttgcgaacggcacctacgagccgacgaaatcctattcc
ttcgccgcacatttcgctgaggtgcatgtcgatacggaaaccggcatcgtggaggtcaag
cgcgtcatacctgtgcacgacgtcggccgggtcatccatccgattgccgcgcaggggcag
atcgagggcggcatccagcagggcatcggtcacacgctgaccgaggactacgtcatcgac
aagaagaccggccggtcgctcaacgccggcctcgtcgactacaagatgccgctctcgatg
gacatgcctgacatcgagacgatcatcctcgaagcggcacccgatccaggtggcccctgg
ggcgccaagggcgtcggcgaggacccgatcattgccatcggcccagccattgccaacgcc
atccacgacgccatcggcgttcgcttccgccactatccgatcactccggaagacgtactg
aaagccttgagggagaaggccgcatga

DBGET integrated database retrieval system