KEGG   Alteromonas australica H 17: EP13_00230Help
Entry
EP13_00230        CDS       T03220                                 

Definition
(GenBank) hypothetical protein
  KO
K00980  glycerol-3-phosphate cytidylyltransferase [EC:2.7.7.39]
Organism
aal  Alteromonas australica H 17
Pathway
aal00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EP13_00230
Enzymes [BR:aal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.39  glycerol-3-phosphate cytidylyltransferase
     EP13_00230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like FAD_syn
Motif
Other DBs
NCBI-ProteinID: AIG00647
UniProt: A0A075P496
Position
complement(50361..50726)
Genome map
AA seq 121 aa AA seqDB search
MYTSGCFDIFHQGHLNILKKTKQLCDYLIVGVSTDELIIQSKGRPPLIPFEERISILESN
RYVDEVIPQVDKNKQKVVDEYRIDAISVGSDWKGKYPSVTCEMVYFDYTPNVSSTVLKRK
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtatacctcagggtgctttgatattttccatcaaggccatctcaatatcctgaaaaaa
accaagcaattatgtgactatttaattgtaggcgtgtctaccgatgagttaattattcag
tcgaaaggtcgccctcccctcattccatttgaagagcgaatttctatattagagtcaaac
cgctatgtggacgaagttatcccacaagtcgataagaataagcaaaaagtggtggatgaa
tatcgtattgatgctatctcggtggggtcggattggaagggtaaatacccaagcgtcact
tgtgaaatggtgtattttgactatacgccaaatgttagctctaccgtattaaagcgcaag
ctgtaa

DBGET integrated database retrieval system