KEGG   Alteromonas australica H 17: EP13_05430Help
Entry
EP13_05430        CDS       T03220                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
aal  Alteromonas australica H 17
Pathway
aal00620  Pyruvate metabolism
aal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EP13_05430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aal02000]
    EP13_05430
Enzymes [BR:aal01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     EP13_05430
Transporters [BR:aal02000]
 Other transporters
  Primary active transporters [TC:3]
   EP13_05430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 GCV_H RnfC_N PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AIF98188
UniProt: A0A075NXK9
Position
1222691..1224481
Genome map
AA seq 596 aa AA seqDB search
MSKPLALTELVLRDAHQSLLATRMRIEDMLPIAEKLDKAGFWSVESWGGATFDACIRYLG
EDPWERIRQLKAAMPNTKQQMLLRGQNLLGYRHYADDVVTRFVERAHENGVDVFRIFDAM
NDMRNLETAIKATVDCGAHAQGTISYTVSPVHNLQLWLDMAKQLEDMGVHSICVKDMAGL
LKPYDCEALISGLKETVKVPIAMQCHATTGLSTATYQKAIDAGIDMLDTAISSMSMTYGH
TATETMVSIVEGTERDTGLSLPHLEEIASYFREVRKKYSKFEGSLKGVDARILLAQVPGG
MLTNMESQLKEQGAEDKFEEVLKEIPRVREDLGFIPLVTPTSQIVGTQSVLNVLTGERYK
SITKETAGVLKGEYGATAAPVNAELQARVLDGNSPITCRPADNIAPELDSLEKELTALAS
TKSISLSNEKIDDILTYALFPQIGLKFLENRGNPDAFEPAPGQDAPTQVTDTSAASQPTS
GSAAAYDVSVDGKRYHVQVAPSGELTHVAPAPAAPQNASAAAPAGNEQSINAPLAGNVFK
VLVRAGDAVSEGDVVMIIEAMKMETEIRSAFTGTVSDVCVGEGDSITSGQPLIMLG
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagccactggccttaaccgagctagtattgcgtgacgcccatcaatcgctactt
gccacacgtatgcgtattgaggatatgttacctattgctgaaaaattagataaagctggc
ttctggtcagttgaatcgtggggaggcgcaacttttgacgcgtgtattcgttatttagga
gaagatccttgggagcgaatcaggcagttaaaggcggccatgcccaataccaagcaacaa
atgcttttacgcgggcaaaatctattggggtatcgtcattatgctgacgacgtggtgact
cgctttgttgagcgcgctcacgaaaatggggtagatgtttttcgaattttcgatgccatg
aatgacatgcgaaatctcgaaacagcaataaaggcaacagtagactgcggtgcccatgca
caaggaacgatttcctacacggtaagccctgttcacaatctgcaactttggctcgatatg
gctaaacagctggaagacatgggggttcactctatttgtgtgaaagacatggctggcctt
cttaagccttacgattgtgaagccctaattagtggcctaaaggaaacggtgaaggtgcct
attgctatgcagtgtcatgcaaccaccggattaagtacagccacttaccagaaagccatt
gatgctggtatagatatgctggataccgctatctcatcgatgagtatgacctatggtcat
acggcaacagaaaccatggtgtctatagtagaaggtaccgaaagagatacaggtctctct
ttgcctcaccttgaagaaatcgctagttactttagggaagtgcgcaaaaaatacagtaaa
tttgaaggcagcctcaaaggggttgatgctcgaattttattggcgcaagtgccaggtggc
atgttaaccaatatggaaagccagctaaaagagcagggcgctgaagacaagtttgaagaa
gtattgaaagaaattccccgtgtaagagaagatctcggctttattcctctggtaacaccg
acgtcgcaaattgtgggtacacaatcagtattaaatgtactcactggtgagcgctataag
agtattacgaaagaaacggctggggtccttaaaggtgaatacggtgcgacagcagcgcca
gtcaatgctgaacttcaagcccgcgtgttagatggcaacagcccaataacatgtcgtcca
gccgataatattgcgcctgaattagacagtttagagaaagaacttaccgcactagccagt
acaaaatctatctcattaagcaacgaaaaaattgacgatattctcacctatgctctgttt
cctcaaataggcttaaaatttttggaaaacaggggcaatccagacgcctttgagccagcg
ccagggcaagacgcgccaacgcaagtgacagatacttcagcggcctctcaacctacttct
ggttcagccgcagcgtacgacgtcagtgtggacggaaagcgttatcatgtccaagtggca
ccgtctggtgaactcactcatgttgctccagcaccggctgcgccacaaaatgcgtctgca
gcagcgccagcaggtaacgagcagtcaattaatgcaccgctagcaggaaacgtgtttaaa
gttcttgtgcgtgccggagacgcggtgtcagaaggcgatgtggtcatgattatcgaagcg
atgaaaatggaaactgaaattcgttcagcctttacaggcactgtcagtgatgtgtgtgtg
ggtgaaggcgatagcatcaccagtggtcagcctttgataatgttggggtag

DBGET integrated database retrieval system