KEGG   Alteromonas australica H 17: EP13_05490Help
Entry
EP13_05490        CDS       T03220                                 

Gene name
phhA
Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
aal  Alteromonas australica H 17
Pathway
aal00360  Phenylalanine metabolism
aal00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aal00790  Folate biosynthesis
aal01100  Metabolic pathways
aal01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    EP13_05490 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EP13_05490 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EP13_05490 (phhA)
Enzymes [BR:aal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     EP13_05490 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AIF98199
UniProt: A0A075NU62
Position
1234036..1234836
Genome map
AA seq 266 aa AA seqDB search
MTKETNYQSRQPDDKGLIAWSPEENLVWTELYARQRPLIEKRACEQYLKGMELLKLPKDG
IPQLPDIDKVLMANTGWKTAAVPALINFGEFFRLLANKQFPVATFIRTREQFDYLQEPDI
FHEVFGHCPLLTNPAFAHFTHTYGKLGLKASKEDRVFLARLYWFTVEFGLVKSGNDLKIY
GGGILSSPGETVYSLDSDVPLRQPFTVLDALRTPYRIDIMQPLYYILPSFDHLFDIAEMD
IMTWVEKAKSHGLFPALFDTKARQAS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaaacgaattaccagtcgcgtcaacctgacgataaaggcttgatagcctgg
tcaccagaagagaaccttgtctggacagagctttatgcgcgccaacgccccctaattgaa
aagcgggcgtgcgagcaatatttaaagggtatggagttactcaagcttcccaaagatggc
attccacaattacccgatattgacaaggtacttatggcgaacacggggtggaaaacagcc
gccgttcccgcgttgattaattttggcgagttttttcgtttgctagccaataagcaattt
ccggtagcgacttttattcgtacccgggaacagtttgattatttgcaagaacccgacatc
tttcatgaagtatttggccattgcccacttttaaccaaccctgcctttgctcactttact
cacacttacggcaagctagggctaaaagccagtaaagaagaccgcgtgttcttggcgagg
ttatattggttcaccgtagaatttgggttagtgaagtctggcaacgacctgaaaatttat
ggtggaggcattctctcatcgccgggagaaaccgtgtattcactggacagtgatgtacca
ttaagacagccatttacggttttagatgcgctgagaacaccctatcgcatcgatatcatg
cagccgttatattacattttgccttcgtttgatcatttgtttgacatcgccgagatggac
attatgacgtgggttgaaaaagctaaatcccatgggcttttccctgcgttatttgacacg
aaagcacgacaagccagctag

DBGET integrated database retrieval system