KEGG   Alteromonas australica H 17: EP13_08335Help
Entry
EP13_08335        CDS       T03220                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aal  Alteromonas australica H 17
Pathway
aal00071  Fatty acid degradation
aal00072  Synthesis and degradation of ketone bodies
aal00280  Valine, leucine and isoleucine degradation
aal00310  Lysine degradation
aal00362  Benzoate degradation
aal00380  Tryptophan metabolism
aal00620  Pyruvate metabolism
aal00630  Glyoxylate and dicarboxylate metabolism
aal00640  Propanoate metabolism
aal00650  Butanoate metabolism
aal00900  Terpenoid backbone biosynthesis
aal01100  Metabolic pathways
aal01110  Biosynthesis of secondary metabolites
aal01120  Microbial metabolism in diverse environments
aal01130  Biosynthesis of antibiotics
aal01200  Carbon metabolism
aal01212  Fatty acid metabolism
aal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EP13_08335
   00630 Glyoxylate and dicarboxylate metabolism
    EP13_08335
   00640 Propanoate metabolism
    EP13_08335
   00650 Butanoate metabolism
    EP13_08335
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EP13_08335
   00072 Synthesis and degradation of ketone bodies
    EP13_08335
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EP13_08335
   00310 Lysine degradation
    EP13_08335
   00380 Tryptophan metabolism
    EP13_08335
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EP13_08335
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EP13_08335
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EP13_08335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aal04147]
    EP13_08335
Enzymes [BR:aal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EP13_08335
Exosome [BR:aal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EP13_08335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIF98691
UniProt: A0A075NYP5
Position
1827862..1829037
Genome map
AA seq 391 aa AA seqDB search
MSEESVVIVAAKRTPMGGFNGSLSGVTATDLGATAIKAAYESVGGDNIDEVIMGCVLPAG
LGQSPARQASLAAGLPLGAGVTTINKVCGSGLKAVMLAHDLIKAGSATSIVAGGMESMSN
APYLLPKARSGYRMGHGQVLDHMMLDGLENAYDGKAMGCFAQSTADEQNISRGDMDEFAL
SSLSKAHEAINSGGFSDEIVEVTIKTRKGDVVVDTDEGPGNARPEKIPTLRPAFTKDGTV
TAANSSSISDGAAALVVMSESKAAELGLTPLAKVVAHATHSIEPENFTLAPVGAMKKVLE
KANWVKEEVDLFEINEAFAMVTMMAIRQLQLDEKKVNVKGGACALGHPIGASGARILVTL
LHALKQKNARKGIASLCIGGGEGVALAVEML
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaatctgtagtgatagtggcggctaaacgtacgccaatggggggctttaat
ggctcgttatctggtgttactgctaccgaccttggtgcaacggcgataaaagcggcgtat
gaatcggttggcggcgacaatatcgacgaagttatcatgggttgtgtgctgcctgctggt
ctcggacagtctcctgctcgtcaagcgtcattagccgcaggtctgccgcttggcgctggt
gtaaccactatcaataaagtatgcggttcaggccttaaagcagtcatgcttgctcacgac
cttattaaagcgggcagtgctacaagtattgtcgctggcggcatggaaagtatgagtaat
gcaccgtatttattgcccaaagcccgaagcggttatcgtatgggccacggccaagtactc
gatcatatgatgcttgatggtctggaaaacgcttacgacggaaaggcaatgggctgcttt
gctcaatctacggcggatgaacaaaatattagtcgtggagatatggatgaattcgcctta
agttcgttgtctaaagctcacgaagccattaatagtggtggctttagtgatgaaatagtc
gaggttactattaagactagaaaaggcgacgtggtggtagacaccgatgaaggcccgggt
aatgccagacctgagaaaatacccacattgcgcccggcattcaccaaagacggtacggtc
accgcagccaattcaagttctatctccgatggtgcggcggcattggtggtgatgagtgag
tcgaaagccgctgagttagggttaaccccactggcgaaagtggtcgctcatgccacccat
tctattgaacctgaaaatttcacacttgcgccagtgggggcgatgaagaaggttttagaa
aaagcgaattgggttaaagaagaagtggatttgttcgaaatcaacgaagcgttcgcaatg
gtcactatgatggctattcgtcagttacaattagatgaaaagaaagtgaatgttaaagga
ggcgcctgtgctcttggtcatcctattggcgcatctggggcaagaatcttagtgacgtta
cttcatgcattaaagcaaaaaaatgcacgaaaagggattgcctctttatgcattggtggt
ggcgaaggtgtcgccttggctgtggaaatgctttaa

DBGET integrated database retrieval system