KEGG   Aedes albopictus (Asian tiger mosquito): 109397249Help
Entry
109397249         CDS       T06060                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: autophagy-related protein 16-1-like
  KO
K17890  autophagy-related protein 16-1
Organism
aalb  Aedes albopictus (Asian tiger mosquito)
Pathway
aalb04136  Autophagy - other
aalb04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:aalb00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109397249
   04136 Autophagy - other
    109397249
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aalb04131]
    109397249
   03029 Mitochondrial biogenesis [BR:aalb03029]
    109397249
Membrane trafficking [BR:aalb04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    109397249
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    109397249
Mitochondrial biogenesis [BR:aalb03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    109397249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Nup160 DUF4201
Motif
Other DBs
NCBI-GeneID: 109397249
NCBI-ProteinID: XP_029722771
Position
Unknown
AA seq 541 aa AA seqDB search
MAMGAKQENWRDIIAERLRERNRNETSRYADIIAYNNRLFDAAAKLRQENLELKIDKKNP
RXSSGGTSGTDLNNAQIQALEKKVLAQQEELTDLHKRKGEHSQMVITLNQKLTELQRTLA
EKEKALAEQTAMNVTMRDELEELKTSYITIKDESLAWQLNANSAEERLRGVQEENAKLLK
LLMEYKSRDAEIMNKENDKFFREKKARIESELERAIKDIPGPSSLGGLGSDMDRFDFGSD
GPPEGIEFKFDAHDGEVNAVRWSPVERVVATGGADRKVKLWDVGKGVCEPRGTLVGSNQG
INSVEFDSTGSLILAASNDFASRVWTVSDQRLRHTLTGHSGKVLAAKFLGASFLVTGSHD
RTLKIWDLKNRSCTETKFAGSSCNDLVTTDSFSIISGHFDKKIRFWDTRTADCTANDIPL
QGKITSLDLSKDGKFLLCCVRDDTINLLDLRQNKIVRTFRHDLYKVGCDWARVSFNPTCQ
RIAAGAADGSVYIWNVNGPLETVLKDPNGSGAAVTAVSWHPFSSVLASVDRAKKCTIWSN
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggccatgggtgcgaagcaggaaaactggcgggacatcattgcggaacggctccgggag
cgaaacagaaatgagacatcccgatatgcggatattattgcctacaataatcgtctcttc
gacgcagcagccaaacttcgtcaggagaatctcgagctaaaaatcgacaaaaaaaatccg
cganntagctccggtggaacgtctggaacggatttgaacaacgctcagatccaagcgctc
gagaagaaggtgctagcccaacaggaagagctaaccgaccttcacaagcgcaagggtgaa
cattcccagatggtcattactttgaaccaaaagctgaccgaattacaacgaacactggcc
gaaaaggagaaagccctagcggaacaaactgcaatgaacgtgaccatgagggacgagctg
gaagagcttaagacttcatacattacaatcaaggacgaatccttagcctggcagctaaat
gcaaactctgcggaagagcgactaagaggtgttcaagaagaaaatgctaaactgttgaaa
ttactgatggaatacaaatcgcgcgatgcggagattatgaacaaagaaaacgacaagttt
ttccgagaaaagaaagctcgaattgaaagtgaactggaacgagcaatcaaggacattccg
ggcccatcgtcattgggcggtttgggatccgatatggatcgattcgatttcggttccgat
ggccctccggagggcatagagtttaaattcgatgctcatgacggcgaagtgaacgcggtt
cgctggagtcccgtagagcgagtggttgctactggtggtgctgataggaaagtaaagcta
tgggatgtgggaaaaggtgtttgtgaacccagaggtactttggttggtagtaaccagggc
atcaattcagtggaatttgatagcaccggttcgttgattctagctgcttcaaatgacttt
gccagtcgcgtgtggaccgtttctgatcaacgtcttaggcacactctgacggggcacagc
ggcaaggtgctggcggcgaagtttctcggtgcctccttcctggtcacggggagccacgat
cggacgctgaaaatctgggacctcaaaaatcggtcgtgtaccgaaacgaaattcgccggc
tccagctgcaacgatctggtcacgaccgacagcttttccatcattagtgggcactttgat
aagaaaatccgtttctgggacacccgaacggccgactgcaccgccaacgacatcccgctg
caggggaaaatcacctccctggacctgtccaaggacggcaagtttctgctgtgctgcgtg
cgggacgataccatcaacctgctggacctgcggcagaacaaaattgtacggacattccga
cacgatctctacaaagtgggttgcgactgggctcgggtgtctttcaatcccacttgtcaa
agaatcgcggccggtgcggctgacgggtccgtttacatctggaatgtgaacggcccgctg
gagacagtgttaaaggatcctaatggaagtggcgccgccgtgaccgccgtcagttggcac
ccgtttagctccgtcctggcatcggtagaccgggccaaaaagtgcacaatttggtctaac
gcttag

DBGET integrated database retrieval system