KEGG   Aedes albopictus (Asian tiger mosquito): 109400253Help
Entry
109400253         CDS       T06060                                 

Definition
(RefSeq) heat shock protein 70 A1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
aalb  Aedes albopictus (Asian tiger mosquito)
Pathway
aalb03040  Spliceosome
aalb04141  Protein processing in endoplasmic reticulum
aalb04144  Endocytosis
aalb04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:aalb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109400253
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109400253
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109400253
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109400253
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aalb01009]
    109400253
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:aalb03041]
    109400253
   03009 Ribosome biogenesis [BR:aalb03009]
    109400253
   03110 Chaperones and folding catalysts [BR:aalb03110]
    109400253
   04131 Membrane trafficking [BR:aalb04131]
    109400253
   03051 Proteasome [BR:aalb03051]
    109400253
   03029 Mitochondrial biogenesis [BR:aalb03029]
    109400253
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aalb04147]
    109400253
Protein phosphatases and associated proteins [BR:aalb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     109400253
Spliceosome [BR:aalb03041]
 Complex B
  Other components
   Prp19 complex
    109400253
 Complex C
   Prp19-CDC5 complex
    109400253
Ribosome biogenesis [BR:aalb03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109400253
Chaperones and folding catalysts [BR:aalb03110]
 Heat shock proteins
  HSP70 / DNAK
   109400253
Membrane trafficking [BR:aalb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    109400253
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    109400253
Proteasome [BR:aalb03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    109400253
Mitochondrial biogenesis [BR:aalb03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    109400253
Exosome [BR:aalb04147]
 Exosomal proteins
  Proteins found in most exosomes
   109400253
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl DUF4795 StbA FGGY_C
Motif
Other DBs
NCBI-GeneID: 109400253
NCBI-ProteinID: XP_029725161
Position
Unknown
AA seq 639 aa AA seqDB search
MSAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSCVAFSDTERLIGDAAQNQVALNP
RNSVFDAKRLIGRRFDDPKIQADLKHWPFKVINDNGKPKIEVEFKGEVKKFSAEEISSMV
LVKMKECAEAYLGRNIKNAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAY
GLDKNLKGERHVLIFDLGGGTFDVSILTIDEGSLFEVKATAGDTHLGGEDFDNRMVAHFV
EEFKRKYRKDITPNARALRRLRTACERAKRTLSSSTEATIEIDALADGIDFYTKISRARF
EELCADLFRSTLQPVERALSDAKMDKASIHDIVLVGGSTRIPKVQSLLQNFFSGKSLNLS
INPDEAVAYGAAIQAAILSGDKDEKIQDVLLVDVAPLSLGIETAGGVMSKLVERNTRIPC
KQTQIFTTYADNQPGVSIQVFEGERAMTKDNNRLGQFDLSGIPPAPRGVPQIEVTFDLDA
NGILNVTAKDKSSGNEKNITIKNDKGRLSQAEIDRMVADAERYHEEDEKLRESIAARNKL
ENYCFQLKHSLETAEDKLSESDKNTVKERCDETLQWLDANSLASKEELDHKMDELSRICS
PIMTRLHQGAGGPGGAGGNRFSSGGGPGGRQGPTVEEVD
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaattggtatcgatttgggaaccacgtactcctgcgtgggtgtgttccagcat
ggcaaagtggaaatcatcgccaacgaccagggaaatcggaccactcccagttgtgtggcc
ttttcggacacggagcggctgattggcgatgcggcacagaaccaggtggccctgaatccg
aggaactcggtgttcgatgcgaagagactgattggccgtcggttcgacgatccgaagatt
caggccgatctgaagcactggccgttcaaggtgattaacgataatggcaaaccgaagatt
gaggtggaattcaagggcgaggtcaagaaattctcggcggaggaaatcagctcgatggtt
ctggtgaagatgaaggaatgtgctgaggcttatttggggcggaacatcaagaacgcggtc
attacagttccggcgtatttcaacgattcccagcgtcaggccacgaaggacgccggagcc
attgccgggctcaacgtgatgagaatcatcaatgaaccgacggcggccgctttggcctac
ggtctggacaagaatcttaaaggtgagcgtcatgtcttgatcttcgatttgggaggagga
accttcgacgtttctatcctgactatcgacgaaggttcattgtttgaggtgaaagccaca
gctggcgatactcacctgggaggagaggacttcgataatcgcatggtggcccacttcgtg
gaagaattcaagcgcaagtacaggaaggacatcactccgaatgcgcgcgctttgagacgt
ctgcgaacggcatgtgagcgagctaagcgcacactgtcgtccagcactgaggccacaatc
gagatcgacgccctggccgatggaatcgacttctatacgaagatttccagagcccgattt
gaggaactttgcgccgacctattccgatccacccttcaaccagttgaaagagctctgtcc
gacgcaaaaatggacaaagcttcaatccacgacatcgtcctcgtcggcggatcaacccgt
attccgaaggttcaatcccttctccagaacttcttctcaggaaaatcgttgaacttatca
atcaacccggatgaagccgtcgcctacggggcagctattcaagcggctatcctcagcggc
gacaaggatgaaaagattcaggatgtcctcctcgttgacgtggccccactttctctggga
atcgaaacagccggaggagtcatgtccaaactggtcgaacgcaacaccagaatcccgtgc
aagcagacacaaatcttcacgacctacgcggacaaccagccaggagtatcgatccaggtg
ttcgaaggcgaacgcgccatgaccaaggacaacaaccgcctcggtcagttcgacctctcc
ggaatcccgccagccccaagaggcgttccccaaatcgaggtcacattcgacctggacgcc
aacggcattctcaacgtcaccgccaaggacaagagcagcggaaacgagaagaacatcacc
atcaagaacgacaagggccgcctcagccaggctgaaatcgaccgcatggtagccgacgcc
gagcgctaccacgaagaggacgaaaagctccgggaaagcatcgccgccagaaacaaactg
gaaaactactgtttccagctgaaacactccctggagacggccgaggacaagctgagcgaa
tcggataagaacaccgtcaaggaacgctgcgacgaaacgctccaatggctggacgccaat
tcgctggccagcaaggaggaactggaccacaagatggatgagttgagccgcatttgcagt
ccaatcatgacccgcttgcatcagggcgcgggcggccccggaggagctggaggaaatcgg
ttctcgtctggtggcggacctggcggacggcagggacccaccgttgaggaagtcgactaa

DBGET integrated database retrieval system