KEGG   Aedes albopictus (Asian tiger mosquito): 109402491Help
Entry
109402491         CDS       T06060                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase pitchoune
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
aalb  Aedes albopictus (Asian tiger mosquito)
Brite
KEGG Orthology (KO) [BR:aalb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:aalb03041]
    109402491
   03009 Ribosome biogenesis [BR:aalb03009]
    109402491
Enzymes [BR:aalb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     109402491
Spliceosome [BR:aalb03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    109402491
Ribosome biogenesis [BR:aalb03009]
 Eukaryotic type
  90S particles
   Helicases
    109402491
  Pre-60S particles
    109402491
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII
Motif
Other DBs
NCBI-GeneID: 109402491
NCBI-ProteinID: XP_019530721
Position
Unknown
AA seq 603 aa AA seqDB search
MGKKNKLKYKGDTQSTAAQTQNGKASVEDLEENFELETESSKADKKKNKRKNKEAAVGAF
VKRPKHSDDEDAEVAEQDGDEDADVDDEVSETPAVGGGSAYEILLGNQEFETLRGKVSDN
TLKAISEMGFTKMTEIQAKAIPPLLEGRDLIGSAKTGSGKTLAFLIPAVELINKLQFKPR
NGTGVIIISPTRELAMQIFGVLKELMAHHHHTYGLLMGGASRHTENEKLAKGLNIVVATP
GRLLDHLKSTPNFLFKNLQCLVIDECDRILEIGFEEDMKQIISILPKKRQTMLFSATQTS
RTEELGKLALKSEPIYVGVDDHKTEATVTGLEQGYIVCPSEKRLLVLFTFLKKNRKKKVM
VFFSSCLSVKYHHELFNYIDLPVNSIHGKQKQAKRTSVFFQFCNAESGILLCTDVAARGL
DIPAVDWIVQYDPPNDTKEYIHRVGRTARGENICGHALLILRPEEVEFLKYLKQAKVPLN
EFEFSWSKIADIQLQLENLLSKNYFLNQSGKLAFKSYVRAYEGHHMKDVFNVGNLDLVKV
AKNFGFTQPPYVDFGKSYKIQNSDRRAGNRGLGHFKTLNKDKKGEMKFKHIKNRKQLKKI
EYE
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagaaaaacaagttgaaatataaaggagatacgcagtctacggcggcgcaaact
caaaatggcaaagcttccgttgaggatttggaggaaaacttcgaactagaaacggagtct
agcaaggcggacaaaaagaaaaacaagcgcaagaataaggaagccgctgtcggagcgttt
gtcaaaaggccaaaacacagtgacgatgaggatgctgaagtagcggaacaagacggcgac
gaggacgctgacgtagatgacgaggtctcggaaactcctgcggtcggtggtggaagtgcc
tatgaaattctgttgggtaaccaggagtttgaaacgcttcgaggcaaggtttcggataac
acactgaaagccatttccgaaatgggttttaccaaaatgacagaaattcaagctaaagcc
attccaccgctgctggagggacgtgatttgatcgggtcggccaagacgggaagcggaaaa
acgttggcatttttgattccggctgtggagttgattaacaaactgcagtttaagccacgg
aatggcacaggagtgatcatcatttcgcccacccgggaactggcgatgcagattttcggc
gtgctgaaggaactgatggcacatcaccatcacacgtacggactgctgatgggtggagcc
agccggcatacggagaacgagaaactagcgaaagggttgaacattgtggtggccaccccg
ggacggctgctggatcatttgaagagcacgcctaacttcctgttcaagaatttgcagtgc
ttagttatcgatgagtgcgatcgaatcctggagattggatttgaagaggatatgaagcag
attattagtatccttccaaaaaaacgtcaaaccatgctgttctcggcaacgcagacgtcg
cgaacagaagaattaggaaaactagctctgaaatcggaacccatctatgtcggagtggat
gaccataaaacggaagctaccgttacaggtttggagcagggctacattgtatgtccatcg
gagaaacgcctgctggtgctgttcacttttctcaagaagaatcgcaagaagaaggtcatg
gtgttcttttcgtcttgtttgtccgttaaatatcatcacgaattgttcaactacattgac
ctcccggtgaattcgatccatggcaagcagaagcaagccaagcgaacgtcggtgttcttc
cagttctgcaatgcggagtcaggcatcttgctgtgcacagatgtggccgcccgtggtttg
gacattccggccgtcgattggattgtgcagtacgatcctccaaatgacaccaaggaatac
atacaccgcgtcggtcgtacggcccgtggtgaaaacatctgtggccatgcattgctcatt
ctccgtccggaagaggtggaattcctaaagtacctcaaacaagccaaggtaccattgaac
gagtttgaattctcctggagtaaaatcgccgacattcagctgcaactggagaatcttctg
tcgaagaactatttcttgaaccagtcaggtaagttggcattcaaatcgtacgtccgggcg
tacgaagggcaccacatgaaggatgtgttcaacgtgggcaatctggatctggtgaaggtg
gccaagaactttggtttcacgcagccaccatacgtggactttggcaagagctacaagatc
cagaactcggatcgacgggctggtaatagagggctgggtcacttcaaaacgctgaacaag
gacaagaagggtgagatgaagttcaagcatattaagaaccggaaacagctgaaaaagatc
gagtacgagtag

DBGET integrated database retrieval system