KEGG   Aedes albopictus (Asian tiger mosquito): 109416149Help
Entry
109416149         CDS       T06060                                 

Definition
(RefSeq) DNA-directed RNA polymerase I subunit RPA12-like
  KO
K03000  DNA-directed RNA polymerase I subunit RPA12
Organism
aalb  Aedes albopictus (Asian tiger mosquito)
Pathway
aalb03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:aalb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    109416149
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aalb03021]
    109416149
Transcription machinery [BR:aalb03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     109416149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_C Zn_Tnp_IS1595 C1_1 zf_Rg DUF3716 zf-TFIIB zinc-ribbons_6 DZR GFA RNA_POL_M_15KD Baculo_LEF5_C
Motif
Other DBs
NCBI-GeneID: 109416149
NCBI-ProteinID: XP_019545667
UniProt: A0A182H0M9
Position
Unknown
AA seq 139 aa AA seqDB search
MVFTFVYIRSLTSYSAKMDYKSSITPGFCPDCGSILPLLRMTGGVSCYSCHKAYDESVYG
TMEVNYKIHFNSYESRKAEKQQGSQKTAAAAEGPVVSRKCPKCDNDKMSYATVQLRSADE
GQTVFFTCTKCQFKESENS
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggtttttacttttgtttacatccgcagcttaacttcgtattctgctaaaatggactat
aaatcgtcgattacacccggattttgcccggattgtggttccatactgccgttgctacga
atgacgggtggtgtatcctgctacagttgccacaaagcttatgacgaatccgtttacggc
accatggaggtcaattacaagatacatttcaactcatacgaaagtagaaaagcagagaag
cagcaaggtagccagaaaaccgccgctgcagcagaaggtcctgtcgtatcgcgcaagtgt
cctaaatgtgacaacgataagatgtcctatgcaaccgtgcagctgcgatcggcggatgaa
ggacaaactgtgtttttcacctgtaccaaatgccaatttaaggaatccgaaaactcgtaa

DBGET integrated database retrieval system