KEGG   Aedes albopictus (Asian tiger mosquito): 109416369Help
Entry
109416369         CDS       T06060                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: tyrosine-protein phosphatase vhp-1
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
aalb  Aedes albopictus (Asian tiger mosquito)
Pathway
aalb04013  MAPK signaling pathway - fly
aalb04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:aalb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    109416369
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    109416369
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aalb01009]
    109416369
Enzymes [BR:aalb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109416369
    3.1.3.48  protein-tyrosine-phosphatase
     109416369
Protein phosphatases and associated proteins [BR:aalb01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    109416369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase PTPlike_phytase Init_tRNA_PT Y_phosphatase3 PI3K_1B_p101
Motif
Other DBs
NCBI-GeneID: 109416369
NCBI-ProteinID: XP_029730155
Position
Unknown
AA seq 366 aa AA seqDB search
MRIKRESTCLGLRLMPATKLAIHNPHKRHKDTCDDSSITPGTRIPLARSCSSPAVSYDIE
SHPASPVFPHLLLGNGRDAIDPSTVGANCVLNVTCQQPAASLLKPGLEYKQIPASDTPHQ
NIKQYFQEAFEFIEDARKKGSTVLLHCQAGISRSATIAIAYVMRYKAVSLLEAYQMVKLA
RPIISPNLNFMGQLLELEXNLIADGKLDPPPPSPVVPPSQPPFFLINNCSKFNPHDEEMD
NEDDHSEDNKNNNRDSGCSTASTSSTSSGSSIHSTSSRYSHGINSRCPPRLTLKLPTSPP
SSPSSLSSPSSLSSSSSTPSPTQSLAPVPATPVCILAPRPFPMSSSCTSSSSSSSNVRPG
QASSSS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagaataaagcgcgaatcgacctgcctaggattacgactcatgcccgccaccaagctc
gcaattcacaatccgcacaaacggcacaaagatacctgtgatgattcatcgatcacgccc
ggcactcggatcccgctggcacgcagctgttccagcccggccgtttcctacgacatcgaa
tcgcatcccgcatcgcccgtgttcccacatcttctgctcggcaacggccgggacgccatc
gatccgtccaccgtcggagccaactgcgtactgaacgtcacctgccaacagcccgcggcc
agtttgctgaaaccgggcctggagtacaagcagatccccgccagcgacaccccgcatcag
aacatcaagcagtacttccaggaggccttcgaattcattgaggatgcccggaaaaaaggt
tccaccgtgttactgcactgtcaagccggtatcagccgcagcgcaacgattgccatcgcc
tacgtcatgcggtacaaggccgtctcgctgctggaagcataccaaatggtgaaactggcc
cgcccgatcatctcgccgaacctcaacttcatgggccagctgctggagttggagncaaac
ctgatcgccgacggaaagctggatcctccacctccgtcgccagtggtgccacctagtcag
cctccgttcttcctgatcaacaactgcagcaagttcaatccacacgacgaggaaatggac
aacgaagacgaccacagcgaagacaacaagaacaacaaccgagacagtggctgcagcacc
gctagcaccagcagcactagctccggtagcagcatccacagcaccagcagtagatacagc
cacggtatcaatagccggtgcccaccgcggttaacgctgaaactcccgacctcacctcca
tcgtcgccatcttcactctcgtcaccgtcctcgctgtcatcctcgtcctcaacaccctcg
cccacgcagtcgctagcaccagtccctgcaacgcccgtttgcatcctggcaccccgaccg
ttccccatgtccagcagttgcaccagcagcagcagcagcagttccaatgtgaggcctggt
caagcgagttccagctcatga

DBGET integrated database retrieval system