KEGG   Arenibacter algicola: AREALGSMS7_00831Help
Entry
AREALGSMS7_00831  CDS       T04973                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
aalg  Arenibacter algicola
Pathway
aalg00010  Glycolysis / Gluconeogenesis
aalg00020  Citrate cycle (TCA cycle)
aalg00620  Pyruvate metabolism
aalg01100  Metabolic pathways
aalg01110  Biosynthesis of secondary metabolites
aalg01120  Microbial metabolism in diverse environments
aalg01130  Biosynthesis of antibiotics
aalg01200  Carbon metabolism
Module
aalg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aalg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AREALGSMS7_00831 (pckA)
   00020 Citrate cycle (TCA cycle)
    AREALGSMS7_00831 (pckA)
   00620 Pyruvate metabolism
    AREALGSMS7_00831 (pckA)
Enzymes [BR:aalg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     AREALGSMS7_00831 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: ASO04310
UniProt: A0A221USS5
Position
complement(972269..973885)
Genome map
AA seq 538 aa AA seqDB search
MNSSTPSTKSIALETYGITTKKIHYQLAPSRLHEITVEKGMGVTSSTGALAINTGEFTGR
SPMDRFIVKDEITADKIWWGNVNIPFESEKFDALYNKVIKYLNEKELYVRDCFACADDDY
KTNIRVINEYPWSNMFAYNMFLRPTEEELVGFDPEWTVVNAPGFMAKAEEDGTRQHNFAI
LNFTRKIALIGGTGYTGEIKKGIFSALNFILPVFKNCLPMHCSANVGEDGDTAIFFGLSG
TGKTTLSADPHRKLIGDDEHGWTKENTVFNFEGGCYAKVINLSEENEPEIYGAIKKGALL
ENVVLDANGVVDFANTSITQNTRVSYPIYNIDNIQVPSIGKNPKNIFFLTADAFGVLPPI
SKLTPSQAAYHFISGYTAKVAGTEAGVVEPVPSFSACFGAPFMPLHPTKYAEMLSKKMLD
AGVNVWLVNTGWTGGPYGVGTRMKLKYTRAMIHAALSGELGLYSYDKYHIHSVFGVAQPR
ECPGVPTSVLSPRATWNNDEAYYKTAFKLTNAFRENFKKFEVYANEEIRRGGPQRYAF
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaattcatcaacaccctcaactaaatcgattgcgttggagacgtatggtataacaact
aaaaaaattcactatcaattggcaccgtcaagactacatgaaattacagtggaaaagggt
atgggcgtaacctcctctaccggggctttagcaattaatacaggcgaatttacgggtagg
tctccaatggacagatttattgtaaaggatgagattacggccgataaaatttggtgggga
aatgtaaatataccctttgaaagcgaaaagtttgatgctctttacaacaaggtcataaaa
tatctcaatgaaaaggaactttatgtaagggattgttttgcatgcgccgacgatgattac
aagacgaacatcagggtaattaatgaatatccctggtccaatatgtttgcctataatatg
tttttaaggcctaccgaagaagagttggtaggttttgatccggaatggactgtggttaat
gcacctggatttatggcaaaggcagaggaagatgggacaaggcagcataattttgccatt
cttaatttcacccgtaaaattgccctgataggaggtaccggatatacgggggaaattaaa
aaaggaatattttctgcgctgaattttattcttccggtatttaagaattgccttcccatg
cactgttcggcaaacgtgggcgaggatggagataccgcaatcttttttggcctttccgga
actggaaagactacattgtcggcagacccacatagaaaattgattggggatgatgaacac
gggtggaccaaagaaaataccgtatttaattttgagggaggttgttatgccaaggtcata
aatctttcggaagaaaatgaacctgaaatttacggagccataaagaaaggagcccttttg
gagaacgtggtattggatgccaatggggtagtagactttgccaatacctccattacccaa
aataccagagtaagttatcctatttataatatagacaatatacaggtgccgtccattggc
aagaacccaaaaaatattttctttttaactgcggatgcctttggggtattgcctcctatt
tccaagttgacccctagtcaggcagcctatcattttatttcgggatatacggctaaggtg
gccggtaccgaggcaggggtggtagaaccagtgccaagtttttcggcttgttttggagcg
ccgtttatgccattacatccaaccaaatacgcagagatgctgagtaaaaaaatgttggat
gcaggggtaaacgtatggttggtaaatacaggatggaccggtggcccatatggggtgggt
accagaatgaaattgaaatatactagggccatgatccatgcggccttaagtggcgaactg
ggactgtacagttatgataaataccatatccactccgtttttggagtggcacagcctagg
gagtgtcctggagtccctacaagtgtgctaagtccaagggcaacatggaacaatgacgag
gcctattacaaaaccgcctttaagttgaccaatgcctttagggaaaactttaagaaattc
gaggtctatgccaatgaggaaataagacgtggaggaccgcagcgatatgcattctaa

DBGET integrated database retrieval system