KEGG   Alternaria alternata: CC77DRAFT_1019268Help
Entry
CC77DRAFT_1019268 CDS       T05291                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
aalt  Alternaria alternata
Pathway
aalt00010  Glycolysis / Gluconeogenesis
aalt00053  Ascorbate and aldarate metabolism
aalt00071  Fatty acid degradation
aalt00280  Valine, leucine and isoleucine degradation
aalt00310  Lysine degradation
aalt00330  Arginine and proline metabolism
aalt00340  Histidine metabolism
aalt00380  Tryptophan metabolism
aalt00410  beta-Alanine metabolism
aalt00561  Glycerolipid metabolism
aalt00620  Pyruvate metabolism
aalt01100  Metabolic pathways
aalt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CC77DRAFT_1019268
   00053 Ascorbate and aldarate metabolism
    CC77DRAFT_1019268
   00620 Pyruvate metabolism
    CC77DRAFT_1019268
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CC77DRAFT_1019268
   00561 Glycerolipid metabolism
    CC77DRAFT_1019268
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CC77DRAFT_1019268
   00310 Lysine degradation
    CC77DRAFT_1019268
   00330 Arginine and proline metabolism
    CC77DRAFT_1019268
   00340 Histidine metabolism
    CC77DRAFT_1019268
   00380 Tryptophan metabolism
    CC77DRAFT_1019268
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CC77DRAFT_1019268
Enzymes [BR:aalt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CC77DRAFT_1019268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 29110396
NCBI-ProteinID: XP_018387677
JGI: 1019268
UniProt: A0A177DRV2
Position
Unknown
AA seq 497 aa AA seqDB search
MTSVKLTTPQTGEFEQPTGLFINNEFVKAVDGKTFDVINPSTEEVICSVQEATEKDVDIA
VAAARKAFNGPWRKETPENRGKLLNKLADLFEKNADLIAAVEALDNGKAFSMAKNVDVPA
AAGCLRYYGGWADKIEGKVVDTAPDSFNYIRKEPIGVCGQIIPWNFPILMWSWKIGPAIA
TGNTVVLKTAEQTPLSAYIACKLIQEAGFPPGVINVITGFGKIAGAAMSAHMDIDKIAFT
GSTVVGRQIMKSAAGSNLKKVTLELGGKSPNIVFADADLDEAIHWVNFGIYFNHGQACCA
GSRIYVQEEIYDKFIQRFKERAAQNAVGDPFAADTFQGPQVSQLQFDRIMGYIEEGKKSG
ATVETGGNRKGDKGYFIEPTIFSNVTEDMKIQQEEIFGPVCTISKFKTKADVIKIGNNTT
YGLAAAVHTSNLTTAIEVANALRAGTVWVNSYNTLHWQLPFGGYKESGIGRELGEAALDN
YIQTKTVSIRLGDVLFG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacatctgtaaagctcacaaccccccagacgggcgagttcgagcagcccaccggactc
ttcatcaacaatgagttcgtaaaggccgttgacggcaaaacctttgatgttatcaacccc
tccactgaggaggtcatctgcagtgttcaggaggccaccgagaaggatgttgacatcgct
gttgctgccgcccgcaaagccttcaacggcccatggcgaaaggagacaccagagaacagg
ggaaagctgcttaacaagcttgccgatctgttcgagaagaatgccgacctcattgctgcc
gtcgaggctctcgacaacggcaaggccttcagcatggccaagaatgtcgatgttcccgcc
gccgctggttgcctgaggtactacggaggatgggccgacaagattgagggcaaggtcgtc
gacacagcacccgacagcttcaactacatccgcaaggagcctattggtgtttgcggtcaa
atcatcccatggaacttccctattctcatgtggtcatggaagattggtcctgccatcgcc
actggtaacaccgtcgtcctgaagactgctgaacagacacctctctccgcatacattgct
tgcaaactgattcaggaggccggtttcccaccaggtgtcatcaacgtcatcactggtttc
ggaaagatcgccggtgctgccatgtccgctcacatggacattgacaagattgccttcact
ggttcaaccgttgtcggccgtcaaatcatgaagtctgccgctggctccaacttgaagaag
gtcactctcgagctcggaggcaagagccccaacattgtcttcgccgacgcagatcttgac
gaggctatccactgggtcaactttggtatttacttcaaccacggacaggcttgctgtgct
ggttcacgtatctacgtccaagaagagatctacgacaagttcatccagcgcttcaaggag
cgggctgctcagaacgctgtcggtgacccattcgccgcggacaccttccagggtcctcaa
gtctcgcagctccagttcgaccgtatcatgggctacatcgaggagggcaagaagtctggc
gcgaccgtcgagactggtggcaaccgtaagggcgacaagggttacttcatcgagcccaca
atcttctccaacgtaaccgaggatatgaagattcagcaagaagagatcttcggccccgtc
tgcacaatctccaagttcaagacaaaggccgatgtcatcaagattggtaacaacaccaca
tacggtcttgctgccgctgtacacacatccaacctcaccactgccattgaggttgccaac
gcgctccgtgcaggaactgtctgggtcaactcctacaacactcttcactggcaacttccc
ttcggggggtacaaggagtctggtattgggcgcgagttgggagaggcggcgctggacaac
tacatccagaccaagaccgtgtctattcgtcttggcgatgttctgttcggttaa

DBGET integrated database retrieval system