KEGG   Alternaria alternata: CC77DRAFT_1029827Help
Entry
CC77DRAFT_1029827 CDS       T05291                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
aalt  Alternaria alternata
Pathway
aalt00052  Galactose metabolism
aalt00500  Starch and sucrose metabolism
aalt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CC77DRAFT_1029827
   00500 Starch and sucrose metabolism
    CC77DRAFT_1029827
Enzymes [BR:aalt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CC77DRAFT_1029827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 29112139
NCBI-ProteinID: XP_018388252
JGI: 1029827
UniProt: A0A177DUI6
Position
Unknown
AA seq 577 aa AA seqDB search
MPSHLSVLAAIGGLLTFGHAQVSSNTTASATSTSTYSQSDVPTGTPLPGDYDEPLRPQVH
YSPPVGFMNDPNGMYVDEDGVYHLYYQYNPTANVAGNQHWGHATSEDLYTWTNQPIALFP
GGPTEGVFSGSAVIDSNNTSGFFPNQTNGVVAIYTINVPENQTQHIAYSHDNGYSFTKYE
NNPVIVPGGTNPTQFRDPKVIWYEPTESWVMVVAYPVDFEVGIFTSPNLIDWTPTSNFSH
HGITGLQYECPNMVEMRVENSTDGDESKYVMLISINPGAPLGGSITEYFVGTFNGTHFEA
DDARTRLTDFAKDNYAGQFFYGIPAEEDQVTLNWASNWQYTNVVPTAGEAVGDGFRSVMT
VPRGHYLKDLPRQGLSLISYPSDIMSIVDSELASNDSLGNGTVFVDYSTVESGALYFEAN
VTGITGGPSLAGSISFTFQSSVSGESISGGTFISSGDVWLDRGKTDAFQSPYFTDKFTAT
GLYNEDDGSWRISGIIDRSIIEIFLNGGELSATSVFFPTQPLDTMMLRVSGLNETVTASV
GVWGLQAAWLNQADENGIVAGNTTESGNSTAGAAKLL
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgccttcccatctatccgtcctcgcagccattggcggcctgctcacgtttgggcatgca
caagtgtcatccaacacaacggcatcggctacgagcacatctacatactcgcaatctgat
gtgccgacgggaacaccattgccgggcgactatgatgagccacttcgacctcaagttcac
tacagcccacccgtagggttcatgaatgatcccaatggcatgtatgttgatgaagatggt
gtatatcacttgtattatcagtacaaccctaccgcaaacgtcgctggcaaccagcactgg
ggtcatgctactagcgaagacctctatacatggaccaaccagcccattgctctcttccct
ggtggccccacagaaggagttttttcgggatcagctgtcatcgattcgaataacaccagc
ggtttcttcccaaaccagaccaacggcgtggtcgcaatctacaccatcaatgtccccgag
aaccagactcagcacattgcctactcgcatgacaacggctactccttcaccaaatatgag
aacaaccctgtcatcgtacccggtggcactaaccccacccaattccgtgatccaaaggtg
atctggtatgagcccaccgagagctgggtcatggttgtggcgtaccccgttgacttcgag
gtcggcatctttactagtcccaatctcatcgactggacgcctacgtcaaacttttcccac
cacggtatcactggtctgcagtacgagtgcccgaacatggtcgagatgcgcgtggagaac
tctaccgacggtgatgaatccaaatacgttatgcttatctcaatcaatccgggtgcaccg
ctcggtggatctatcacagagtactttgttggaacattcaacggcacgcatttcgaagcc
gacgatgcgcgcactaggctcacggatttcgcaaaggataactatgctggacagttcttc
tatggtattcctgccgaggaagaccaggttacgcttaactgggcaagcaactggcaatac
accaacgttgttcccactgctggcgaggctgtaggtgatggtttcaggagtgtcatgacg
gtgccaagaggccactacctgaaggatctccctcgccagggtctgtcgctgatttcgtac
ccttcagacatcatgtctatcgtcgactcggagttagcttccaacgactcccttggtaac
ggtaccgtctttgttgactactccaccgttgagtcaggcgcgctctacttcgaagccaac
gttactggtatcactggtggtccttcccttgccggatctatcagcttcaccttccagtct
tctgtatcgggagagtcaatttcaggtggcactttcatctcatccggcgacgtgtggcta
gaccgcgggaagaccgacgctttccaaagcccttacttcaccgataagttcactgctaca
ggtctttacaatgaggatgacgggtcatggaggatctctggcatcatcgacaggagcatt
atcgagatcttcctgaacggtggcgaactcagtgcaacttcggtcttctttcctacacag
cctcttgacacgatgatgctgagggtttcgggcttgaacgagacagtgacggccagtgta
ggtgtctggggacttcaggctgcttggctaaaccaggcagatgagaatggtattgttgct
ggcaatacgaccgaaagtggtaactcaactgcgggagctgcaaagcttctctag

DBGET integrated database retrieval system