KEGG   Alternaria alternata: CC77DRAFT_1047608Help
Entry
CC77DRAFT_1047608 CDS       T05291                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
aalt  Alternaria alternata
Pathway
aalt03013  RNA transport
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    CC77DRAFT_1047608
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:aalt03012]
    CC77DRAFT_1047608
Translation factors [BR:aalt03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    CC77DRAFT_1047608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 29113093
NCBI-ProteinID: XP_018389227
JGI: 1047608
UniProt: A0A177DWE1
Position
Unknown
AA seq 856 aa AA seqDB search
MASRFFAASDSSSEESSEEELYSNDEESEQEDSDKDSDDESDDDDSDSDSGSETGANRFL
KDASSDSESDDEDVNKVLKSAKDKRFDELEATIRLIENAQKISDWAVISEQFDKLIRQVP
TLTKQNDGKIPKLYIQAVADLETAVVETHEKQKVTPKKMNAVNGRGFNAVRQKIKKHNRD
YEKDINAYRENKEEFMREEEEIVQAPKEKKKKNKIPQLGTDVVEEATDDGFITVGAGGKA
VLYTAEGILKHLRAIVEQRGRKNSDKLEHIRTLEKLFDVAVNDYQKVRVLLTLISTRFDL
TSGTASHMHQEQWKLADQEFGKLLQILEDSNEIVVIENAEEWEDDEKLPTITPGEIFRIP
GSIVSFVERLDDELTRSLQHIDPHTSEYIERLTDEALLYAQLVRTLVYVESMKKNPSLEL
PQEPLNRIVMRRLEHVYFKPSQVITILENNVWKAIPESLDSEITPRAISNDTASLVQTLC
TYLFQNSEGIIRARAMLCQIYFLSLHDQYYKARDMMLMSHLQETISNFDVNTQILFNRAL
VQVGLCAFRAGLVYEAQTSLQEICGSNRQKELLAQGLQMQRYSQISPEQERLERQRQLPF
HMHINLELLECVYLTCSMLLEIPLLAQLGSSPDLRKRVISKTYRRLLEYHERQIFTGPPE
NTRDHVMQASKALSAGEWKKAAEFINSIKIWELMADSEKIKEMLSSQIQEEGLRTYLFTY
APFYDTLSISTLAGMFELSERKVSAVVSKMISHEELAAALDQVNSAIIFRKGVELSRLQT
LALSLSDKASGLIESNEKTLEQRTQGTANAFERQGGRGNRGGRGGGRGGGGRGGGGPRGG
RNQQFTGGALGRAIQA
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccgtttctttgccgccagcgacagctcctcggaagagtccagcgaggaggaa
ctctactccaacgacgaggagtctgaacaggaagacagcgacaaggattccgatgatgag
tccgatgacgacgactccgactccgactcgggttcggaaactggtgccaaccgcttcttg
aaggacgcttccagcgacagcgagagcgacgacgaggatgtgaacaaggtgctgaagagt
gccaaggacaagcgcttcgacgagttggaggcaaccattaggctcattgagaatgcgcaa
aagatcagcgactgggctgtcatttccgaacagttcgacaagctcatccgccaggtgcca
acccttaccaagcagaacgatggcaagatccccaagctctacattcaggccgtcgccgac
ctcgagacggctgtagttgagacacacgagaagcagaaggtcactcccaagaagatgaac
gctgtcaacggtcgtgggttcaacgctgtccgtcaaaagatcaagaagcacaaccgcgac
tacgagaaggacatcaacgcataccgggagaacaaggaggaattcatgcgcgaggaggag
gagattgttcaggcacccaaggaaaagaagaagaagaacaagatccctcaactcggtacc
gacgtcgttgaggaggcgaccgacgatggcttcatcacagtcggagctggtggcaaggct
gtcctatacaccgctgagggtatcctcaaacacttgcgtgctattgtcgagcagcgcggt
cgcaagaactcggacaagctggagcacatccggacactggagaagttgttcgacgtagcc
gtcaacgactaccagaaggtccgcgttctcttgacccttatctcgacgcgcttcgatttg
acctccggtactgccagccacatgcatcaggagcagtggaagcttgcggaccaagaattc
ggaaagctcctccagatcctcgaggacagcaacgagattgttgtcattgagaacgccgag
gagtgggaggacgacgagaagctgcccactatcacacctggcgagatcttccgcatccca
ggaagcatcgtttcctttgttgagaggcttgacgacgaacttactcgctcgctgcagcac
atcgacccacacacttccgagtacatcgaacggttgaccgacgaggcccttctgtacgct
cagctcgtacgcacattggtatacgttgagagcatgaagaagaacccaagcctagaactt
ccacaagaaccactgaaccgcatcgttatgcggagattggaacacgtctacttcaagccc
tcgcaagtcatcacgatcctcgagaacaacgtttggaaggcaattccagagagccttgac
tctgagattaccccccgcgccatctccaacgacaccgcctctctcgtacaaaccctatgc
acatacctgttccagaacagcgagggcatcattcgcgctcgcgccatgttgtgccagatt
tacttcttgtctcttcacgaccagtactacaaggctcgcgacatgatgctcatgtctcac
ttgcaagagactatcagcaacttcgacgtcaacacacaaatcttgttcaaccgtgcgctg
gttcaggtcggcctttgcgctttccgcgccggtctcgtctacgaagcacaaacttcgcta
caagagatctgcggtagcaacaggcagaaggagttgctcgcacaaggtctgcagatgcag
cggtactcccagatctcgcccgagcaagagcgtcttgagcgtcaacgacaacttcccttc
cacatgcacatcaaccttgagctgctagagtgcgtctacttgacttgctctatgttgctt
gagattcctctcctcgcacaactcggctcatcaccagacctcaggaagcgggtgatcagc
aagacctaccgccgtctcttagagtaccatgagcgccagatcttcactggaccgcctgag
aacacccgtgaccacgtcatgcaagcctcgaaggcactgtctgctggtgaatggaagaag
gcagccgagttcatcaactcgatcaagatctgggagctgatggccgattcggagaagatc
aaggaaatgctgtcctcgcaaatccaagaggagggtctccgcacttacctcttcacgtac
gcacctttctacgacacactctccatttccactctagcgggtatgtttgagttgtcagag
cgcaaggtttcggcggtcgtctcaaagatgatctcacacgaggaactcgccgctgctctc
gaccaggtcaactcggccatcatcttcaggaagggtgttgagctgtcaagactccagacg
ctcgcactgagcttatcagacaaggcgtcaggccttatcgagtcgaatgagaagacactg
gagcaacgcacacaaggtaccgccaatgcctttgagaggcaaggtggacgtggtaaccgc
ggtggccgaggaggcggccgtggcggtggtggtcgtggaggaggcggaccaaggggagga
aggaatcagcagttcactggtggtgctttgggacgtgccatccaggcttag

DBGET integrated database retrieval system