KEGG   Alternaria alternata: CC77DRAFT_1060835Help
Entry
CC77DRAFT_1060835 CDS       T05291                                 

Definition
(RefSeq) succinyl-CoA ligase subunit alpha
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
aalt  Alternaria alternata
Pathway
aalt00020  Citrate cycle (TCA cycle)
aalt00640  Propanoate metabolism
aalt01100  Metabolic pathways
aalt01110  Biosynthesis of secondary metabolites
aalt01130  Biosynthesis of antibiotics
aalt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aalt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CC77DRAFT_1060835
   00640 Propanoate metabolism
    CC77DRAFT_1060835
Enzymes [BR:aalt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     CC77DRAFT_1060835
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CC77DRAFT_1060835
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 29113958
NCBI-ProteinID: XP_018386556
JGI: 1060835
UniProt: A0A177DN27
Position
Unknown
AA seq 328 aa AA seqDB search
MQAIRQPMRSALSKAATRQYATASSQYAETIKNLRINGDTKVLFQGFTGKQGTFHAQQAI
EYGTKVVGGTNPKKAGTEHLGLPVFKNVAEAMKETQASATAIFVPPPVAAASIEEAINAE
VPLIVTITEGIPQHDMVRITDMLKTQSKSRMVGPNCPGIIAPGQCKIGIMPGFIHKRGRV
GIVSRSGTLTYEAVNQTTQAGLGQSLVVGIGGDPFSGTNFIDCLNVFLKDEETDGIIMIG
EIGGTAEEDAADFLKEYNTANKPVVSFIAGISAPPGRRMGHAGAIVSGGKGDANSKITAL
EAAGVTVERSPAKLGSSLYDQFVKRDLI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcaatccggcaaccgatgcgctccgcgctctccaaggccgctaccaggcagtat
gcgaccgcttcctcgcaatatgccgagacgattaagaaccttcgcatcaacggcgacacc
aaggtcctgttccagggcttcactggaaagcagggaaccttccacgcacaacaggcgatt
gaatacggcacaaaggttgttggaggcacaaaccccaagaaggcgggcactgaacacctt
ggactgcccgtcttcaagaacgtagcagaggccatgaaggagactcaagcttccgctact
gccatcttcgttcccccaccggtcgctgccgccagtatcgaggaggccatcaacgcagag
gttcccctgattgtgactatcactgagggtatcccacagcacgacatggtccgtatcaca
gatatgctcaagacccagagcaagtctcgcatggttggccccaactgccccggtatcatc
gctcccggccaatgcaagatcggtatcatgccaggcttcattcacaagcgtggccgcgtc
ggtattgtctcccgttccggaactctcacatacgaagccgtcaaccagactacccaagcc
ggccttggccagtcgctggtcgtcggtatcggtggtgaccccttctctggaaccaacttc
atcgactgcctgaacgtcttcttgaaggacgaagagactgatggtatcatcatgattggt
gagattggcggtaccgctgaggaggatgctgcagacttcttgaaggagtacaacactgcc
aacaagcccgttgtcagtttcattgctggtatttccgcgcccccaggcaggaggatgggt
cacgccggtgctattgttagcggtggaaagggcgatgccaactccaagatcaccgcgctt
gaggctgctggtgtcaccgttgagcgctcccccgccaagcttggttcatctctctacgac
cagttcgtcaagcgcgacttgatataa

DBGET integrated database retrieval system